Recombinant Human Carbonic Anhydrase 4/CA4 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKLEHHHHHH |
Source: E.coli.
MW :31.43kD.
Recombinant Human Carbonic Anhydrase 4 is produced by our E.coli expression system and the target gene encoding Ala19-Lys283 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 4 (CA4) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Carbonic anhydrase 4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Carbonic anhydrase 4 may stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It may have a role in inherited renal abnormalities of bicarbonate transport. Furthermore, Carbonic anhydrase 4 is essential for acid overload removal from the retina and retina epithelium and acid release in the choriocapillaris.
MW :31.43kD.
Recombinant Human Carbonic Anhydrase 4 is produced by our E.coli expression system and the target gene encoding Ala19-Lys283 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 4 (CA4) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Carbonic anhydrase 4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Carbonic anhydrase 4 may stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It may have a role in inherited renal abnormalities of bicarbonate transport. Furthermore, Carbonic anhydrase 4 is essential for acid overload removal from the retina and retina epithelium and acid release in the choriocapillaris.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : Specific Activity is greater than 614.96pmol/min/ug
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Expressed in the endothelium of the choriocapillaris in eyes (at protein level). Not expressed in the retinal epithelium at detectable levels. |
| BioGrid: | 107217. 7 interactions. |
|
There are currently no product reviews
|

















.png)







