Recombinant Human Carbonic Anhydrase-Related Protein 11/CA11 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRVDHHHHHH |
Source: Human Cells.
MW :35.1kD.
Recombinant Human Carbonic Anhydrase 11 is produced by our Mammalian expression system and the target gene encoding His24-Arg328 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase-Related Protein 11 (CA11) is a secreted protein member of the a-carbonic anhydrase family. Carbonic Anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA11 is expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. CA11 may play a general role in the central nervous system.
MW :35.1kD.
Recombinant Human Carbonic Anhydrase 11 is produced by our Mammalian expression system and the target gene encoding His24-Arg328 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase-Related Protein 11 (CA11) is a secreted protein member of the a-carbonic anhydrase family. Carbonic Anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA11 is expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. CA11 may play a general role in the central nervous system.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. |
| BioGrid: | 107224. 6 interactions. |
|
There are currently no product reviews
|



















.png)









