Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2/CD157 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH |
Source: Human Cells.
MW :30.3kD.
Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2 is produced by our Mammalian expression system and the target gene encoding Ala25-Glu285 is expressed with a 6His tag at the C-terminus. CD157 is a glycosyl phosphatidylinositol anchored membrane protein that belongs to the CD38 family. CD157 was discovered in a bone marrow stromal cell line where it facilitates preBcell growth. Along with CD38, CD157 is a bifunctional ectoenzyme that exhibits both ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. CD157 has been predicted to function as a cell surface receptor and an immunoregulatory molecule. CD157 was originally identified as a bone marrow stromal cell molecule (BST-1) with a glycosylphosphatidylinositol (GPI) anchor to bind to the cell surface. CD157 is prevalently expressed by cells of the myeloid lineage. CD157 could act as a receptor with signal transduction capability. Further, it regulates calcium homeostasis and promotes polarization in neutrophils and mediates superoxide (O2-) production in the human U937 myeloid line.
MW :30.3kD.
Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2 is produced by our Mammalian expression system and the target gene encoding Ala25-Glu285 is expressed with a 6His tag at the C-terminus. CD157 is a glycosyl phosphatidylinositol anchored membrane protein that belongs to the CD38 family. CD157 was discovered in a bone marrow stromal cell line where it facilitates preBcell growth. Along with CD38, CD157 is a bifunctional ectoenzyme that exhibits both ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. CD157 has been predicted to function as a cell surface receptor and an immunoregulatory molecule. CD157 was originally identified as a bone marrow stromal cell molecule (BST-1) with a glycosylphosphatidylinositol (GPI) anchor to bind to the cell surface. CD157 is prevalently expressed by cells of the myeloid lineage. CD157 could act as a receptor with signal transduction capability. Further, it regulates calcium homeostasis and promotes polarization in neutrophils and mediates superoxide (O2-) production in the human U937 myeloid line.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane |
Tissue Specificity: | Expressed in the bone marrow, spleen and thymus in lymphoid organs, and the lung, kidney and heart in non-lymphoid organs. |
There are currently no product reviews
|