Recombinant Human Cathepsin Z/CTSZ (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH |
Source: Human Cells.
MW :32.51kD.
Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.
MW :32.51kD.
Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome |
| Tissue Specificity: | Widely expressed. |
| BioGrid: | 107902. 15 interactions. |
|
There are currently no product reviews
|










.png)












