Recombinant Human Interferon omega -1/IFNW1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH |
Source: Human Cells.
MW :21.1kD.
Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 is expressed with a 6His tag at the C-terminus. Interferon omega-1 is also known as Interferon alpha-II-1and IFNW1. It is a Secreted protein that in humans is encoded by the IFNW1 gene. IFNW1 belongs to the alpha/beta interferon family. Type I IFNs consist of IFN a, beta, t, and g and bind to the type I IFN receptor, whereas IFN-a is the only type II IFN and is specific for the type II IFN receptor. IFNW1 is a recently discovered protein structurally related to IFN-alpha and –beta. It has been shown that IFN-omega 1 similar to that of other human class I IFNs; potent antiviral activity was also observed on cells of bovine and ovine but not of equine or murine origin.
MW :21.1kD.
Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 is expressed with a 6His tag at the C-terminus. Interferon omega-1 is also known as Interferon alpha-II-1and IFNW1. It is a Secreted protein that in humans is encoded by the IFNW1 gene. IFNW1 belongs to the alpha/beta interferon family. Type I IFNs consist of IFN a, beta, t, and g and bind to the type I IFN receptor, whereas IFN-a is the only type II IFN and is specific for the type II IFN receptor. IFNW1 is a recently discovered protein structurally related to IFN-alpha and –beta. It has been shown that IFN-omega 1 similar to that of other human class I IFNs; potent antiviral activity was also observed on cells of bovine and ovine but not of equine or murine origin.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 109689. 2 interactions. |
|
There are currently no product reviews
|






















.png)








