Recombinant Human CD30/TNFRSF8/CD30L Receptor (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mMNaCl, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :65.2kD.
Recombinant Human TNFRSF8 is produced by our Mammalian expression system and the target gene encoding Phe19-Lys379 is expressed with a Fc tag at the C-terminus. CD30, also known as TNFRSF8, is a cell membrane protein of the tumor necrosis factor receptor family, which regulates proliferation/apoptosis and antibody responses. CD30 is expressed by activated, but not by resting, T and B cells. Aberrant expression of CD30 by mastocytosis mast cells and interaction with its ligand CD30L (CD153) appears to play an important role in the pathogenesis and clinical presentation of systemic mastocytosis. CD30 has been considered as a specific diagnostic biomarker of anaplastic large cell lymphoma (ALCL) and classical Hodgkin lymphoma (cHL). CD30 is also a biomarker used for targeted therapy by an antibody–drug conjugate.
MW :65.2kD.
Recombinant Human TNFRSF8 is produced by our Mammalian expression system and the target gene encoding Phe19-Lys379 is expressed with a Fc tag at the C-terminus. CD30, also known as TNFRSF8, is a cell membrane protein of the tumor necrosis factor receptor family, which regulates proliferation/apoptosis and antibody responses. CD30 is expressed by activated, but not by resting, T and B cells. Aberrant expression of CD30 by mastocytosis mast cells and interaction with its ligand CD30L (CD153) appears to play an important role in the pathogenesis and clinical presentation of systemic mastocytosis. CD30 has been considered as a specific diagnostic biomarker of anaplastic large cell lymphoma (ALCL) and classical Hodgkin lymphoma (cHL). CD30 is also a biomarker used for targeted therapy by an antibody–drug conjugate.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Post transnational modification: | Phosphorylated on serine and tyrosine residues. |
| BioGrid: | 107381. 30 interactions. |
|
There are currently no product reviews
|















.png)







