Recombinant Human Chondroadherin/CHAD (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRHVDHHHHHH |
MW :39.3kD.
Recombinant Human Chondroadherin is produced by our Mammalian expression system and the target gene encoding Cys23-His359 is expressed with a 6His tag at the C-terminus. Chondroadherin is a secreted protein that belongs to the small leucine-rich proteoglycan (SLRP) family of SLRP class IV subfamily. Chondroadherin contains one LRRCT domain, one LRRNT domain, and nine LRR (leucine-rich) repeats. It presents in chondrocytes at all ages. Chondroadherin is initially found as a 36-kD matrix protein isolated from bovine cartilage. It is shown to mediate chondrocyte-matrix interactions. Chondroadherin promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin a2 beta1. Chondroadherin may play an important role in the regulation of chondrocyte growth and proliferation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Tissue Specificity: | Present in chondrocytes at all ages. |
BioGrid: | 107526. 3 interactions. |
There are currently no product reviews
|