Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Share:

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Roll over image to zoom in

   

Product code: 32-7638

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : NEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSVDHHHHHH
Gene : Mstn
Gene ID : 17700
Uniprot ID : O08689

Source: Human Cells.
MW :28.4kD.
Recombinant Mouse Growth Differentiation Factor 8 is produced by our Mammalian expression system and the target gene encoding Asn25-Ser265 is expressed with a 6His tag at the C-terminus. Mouse Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues. Experiments in mice have improved that GDF-8 is a key regulator of mesenchymal stem cell proliferation and differentiation, and mice lacking Myostatin encoding gene show decreased body fat and a generalized increase in bone density and strength.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: Synthesized as large precursor molecule that undergoes proteolytic cleavage to generate an N-terminal propeptide and a disulfide linked C-terminal dimer, which is the biologically active molecule. The circulating form consists of a latent complex of the C-terminal dimer and other proteins, including its propeptide, which maintain the C-terminal dimer in a latent, inactive state. Ligand activation requires additional cleavage of the prodomain by a tolloid-like metalloproteinase (PubMed:14671324).
Tissue Specificity: Expressed specifically in developing and adult skeletal muscle. Weak expression in adipose tissue.
BioGrid: 201535. 1 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-CA9 Antibody (girentuximab biosimilar) (WX-G250)

Anti-CA9 Antibody (girentuxima...

details-Anti-CA9 Antibody (girentuximab biosimilar) (WX-G250)
Recombinant human PTGER4 protein with C-terminal human Fc tag

Recombinant human PTGER4 prote...

details-Recombinant human PTGER4 protein with C-terminal human Fc tag
Anti-CD3 epsilon (activation epitope) APC (Clone : APA1/1)

Anti-CD3 epsilon (activation e...

details-Anti-CD3 epsilon (activation epitope) APC (Clone : APA1/1)
Anti-TLR4 Polyclonal Antibody

Anti-TLR4 Polyclonal Antibody

details-Anti-TLR4 Polyclonal Antibody
Monoclonal Antibody to human IL-6

Monoclonal Antibody to human I...

details-Monoclonal Antibody to human IL-6
Camostat (mesylate)

Camostat (mesylate)

details-Camostat (mesylate)
Anti-Human CD274 FITC (Clone : 29E.2A3)

Anti-Human CD274 FITC (Clone :...

details-Anti-Human CD274 FITC (Clone : 29E.2A3)
MIF (Active) Recombinant Protein

MIF (Active) Recombinant Prote...

details-MIF (Active) Recombinant Protein
Monoclonal Antibody to CD24 (Clone: 32D12) FITC Conjugated

Monoclonal Antibody to CD24 (C...

details-Monoclonal Antibody to CD24 (Clone: 32D12) FITC Conjugated
Polyclonal Antibody to HOXA9

Polyclonal Antibody to HOXA9

details-Polyclonal Antibody to HOXA9
Anti-Human CD243 APC (Clone : UIC2)

Anti-Human CD243 APC (Clone : ...

details-Anti-Human CD243 APC (Clone : UIC2)
TGF b 3 HEK Recombinant Protein

TGF b 3 HEK Recombinant Protei...

details-TGF b 3 HEK Recombinant Protein
BSA

BSA

details-BSA
Recombinant Human Proliferating Cell Antigen, S9

Recombinant Human Proliferatin...

details-Recombinant Human Proliferating Cell Antigen, S9

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Recombinant Rat Granulocyte-Macrophage Colony-Stimulating Factor/GM-CSF(C-6His)

Recombinant Rat Granulocyte-Macrophage Colony-Stimulating Factor/GM-CSF(C-6His)

Recombinant Human IL-20 Receptor Subunit a/IL20RA (C-6His)(Discontinued)

Recombinant Human IL-20 Receptor Subunit a/IL20RA (C-6His)(Discontinued)

FSCN1 Recombinant Protein

FSCN1 Recombinant Protein

New Products

Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR2 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

Recombinant TLR9 Protein with human Fc Tag

close

Please Login to write a Review !!


close

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Product code: 32-7638
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart