Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

    Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

    Share:

    Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

    Roll over image to zoom in

       

    Product code: 32-7638

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • More
    • Review   (0)
    Amount : 50 µg
    Content : Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
    Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
    AA sequence : NEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSVDHHHHHH
    Gene : Mstn
    Gene ID : 17700
    Uniprot ID : O08689

    Source: Human Cells.
    MW :28.4kD.
    Recombinant Mouse Growth Differentiation Factor 8 is produced by our Mammalian expression system and the target gene encoding Asn25-Ser265 is expressed with a 6His tag at the C-terminus. Mouse Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues. Experiments in mice have improved that GDF-8 is a key regulator of mesenchymal stem cell proliferation and differentiation, and mice lacking Myostatin encoding gene show decreased body fat and a generalized increase in bone density and strength.

    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
    Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    Subcellular location: Secreted
    Post transnational modification: Synthesized as large precursor molecule that undergoes proteolytic cleavage to generate an N-terminal propeptide and a disulfide linked C-terminal dimer, which is the biologically active molecule. The circulating form consists of a latent complex of the C-terminal dimer and other proteins, including its propeptide, which maintain the C-terminal dimer in a latent, inactive state. Ligand activation requires additional cleavage of the prodomain by a tolloid-like metalloproteinase (PubMed:14671324).
    Tissue Specificity: Expressed specifically in developing and adult skeletal muscle. Weak expression in adipose tissue.
    BioGrid: 201535. 1 interactions.
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-PAX-8 Monoclonal Antibody (Clone:IHC008)

    Anti-PAX-8 Monoclonal Antibody...

    details-Anti-PAX-8 Monoclonal Antibody (Clone:IHC008)
    Anti-MICA/MICB Biotin (Clone : 6D4)

    Anti-MICA/MICB Biotin (Clone :...

    details-Anti-MICA/MICB Biotin (Clone : 6D4)
    Rabbit Polyclonal Antibody to ERK2(Discontinued)

    Rabbit Polyclonal Antibody to ...

    details-Rabbit Polyclonal Antibody to ERK2(Discontinued)
    Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

    Monoclonal Antibody to DOG-1 /...

    details-Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)
    Anti-Human CD230 / Prion Antibody (Clone : EM-21)

    Anti-Human CD230 / Prion Antib...

    details-Anti-Human CD230 / Prion Antibody (Clone : EM-21)
    Polyclonal Antibody to GSK3 Alpha/beta(Phospho-Tyr279/216)

    Polyclonal Antibody to GSK3 Al...

    details-Polyclonal Antibody to GSK3 Alpha/beta(Phospho-Tyr279/216)
    Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594

    Anti-HSP60 Monoclonal Antibody...

    details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594
    gAcrp30 His Recombinant Protein

    gAcrp30 His Recombinant Protei...

    details-gAcrp30 His Recombinant Protein
    Anti-HLA-F Antibody (Clone : 3D11)

    Anti-HLA-F Antibody (Clone : 3...

    details-Anti-HLA-F Antibody (Clone : 3D11)
    Fibronectin Native Protein

    Fibronectin Native Protein

    details-Fibronectin Native Protein
    Mouse IgG2b Isotype Control DyLight<sup>®</sup> 650 (Clone : MPC-11)

    Mouse IgG2b Isotype Control Dy...

    details-Mouse IgG2b Isotype Control DyLight<sup>®</sup> 650 (Clone : MPC-11)
    Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)

    Anti-HSP90 beta Monoclonal Ant...

    details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)
    Anti-HLA-ABCE PE (Clone : TP25.99SF)

    Anti-HLA-ABCE PE (Clone : TP25...

    details-Anti-HLA-ABCE PE (Clone : TP25.99SF)
    Anti-CD81 Monoclonal Antibody (Clone:M38)-Low Endotoxin

    Anti-CD81 Monoclonal Antibody ...

    details-Anti-CD81 Monoclonal Antibody (Clone:M38)-Low Endotoxin

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    rGRO g/CINC-2b Recombinant Protein

    rGRO g/CINC-2b Recombinant Protein

    rSDF 1b Recombinant Protein

    rSDF 1b Recombinant Protein

    TSSK2 Recombinant Protein

    TSSK2 Recombinant Protein

    close

    Please Login to write a Review !!


    close

    Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

    Product code: 32-7638
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart