Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Share:

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Roll over image to zoom in

   

Product code: 32-7638

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : NEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSVDHHHHHH
Gene : Mstn
Gene ID : 17700
Uniprot ID : O08689

Source: Human Cells.
MW :28.4kD.
Recombinant Mouse Growth Differentiation Factor 8 is produced by our Mammalian expression system and the target gene encoding Asn25-Ser265 is expressed with a 6His tag at the C-terminus. Mouse Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues. Experiments in mice have improved that GDF-8 is a key regulator of mesenchymal stem cell proliferation and differentiation, and mice lacking Myostatin encoding gene show decreased body fat and a generalized increase in bone density and strength.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: Synthesized as large precursor molecule that undergoes proteolytic cleavage to generate an N-terminal propeptide and a disulfide linked C-terminal dimer, which is the biologically active molecule. The circulating form consists of a latent complex of the C-terminal dimer and other proteins, including its propeptide, which maintain the C-terminal dimer in a latent, inactive state. Ligand activation requires additional cleavage of the prodomain by a tolloid-like metalloproteinase (PubMed:14671324).
Tissue Specificity: Expressed specifically in developing and adult skeletal muscle. Weak expression in adipose tissue.
BioGrid: 201535. 1 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Recombinant Human ACE2 Protein with His and Avi tag

Recombinant Human ACE2 Protein...

details-Recombinant Human ACE2 Protein with His and Avi tag
Recombinant human PTGER4 protein with C-terminal human Fc tag

Recombinant human PTGER4 prote...

details-Recombinant human PTGER4 protein with C-terminal human Fc tag
Recombinant Human Endothelial Cell Adhesion Molecule/PECAM-1/CD31 (C-Fc)

Recombinant Human Endothelial ...

details-Recombinant Human Endothelial Cell Adhesion Molecule/PECAM-1/CD31 (C-Fc)
Anti-Human CD11a (Efalizumab) – APC

Anti-Human CD11a (Efalizumab) ...

details-Anti-Human CD11a (Efalizumab) – APC
Cas9 Stable Cell Line

Cas9 Stable Cell Line

details-Cas9 Stable Cell Line
Anti-Hairy Cell Leukemia Monoclonal Antibody (Clone:IHC687)

Anti-Hairy Cell Leukemia Monoc...

details-Anti-Hairy Cell Leukemia Monoclonal Antibody (Clone:IHC687)
Anti-alpha-tubulin Monoclonal Antibody (Clone:TU-02)

Anti-alpha-tubulin Monoclonal ...

details-Anti-alpha-tubulin Monoclonal Antibody (Clone:TU-02)
Monoclonal Antibody to human IL-6

Monoclonal Antibody to human I...

details-Monoclonal Antibody to human IL-6
Rabbit Polyclonal Antibody to Histone 2B(Discontinued)

Rabbit Polyclonal Antibody to ...

details-Rabbit Polyclonal Antibody to Histone 2B(Discontinued)
Rat Anti-Mouse CD22-LENA™ (Low Endotoxin No Azide)

Rat Anti-Mouse CD22-LENA™ (Lo...

details-Rat Anti-Mouse CD22-LENA™ (Low Endotoxin No Azide)
Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : 136-4B5)

Monoclonal Antibody to CD45 / ...

details-Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : 136-4B5)
Polyclonal Antibody to HOXA9

Polyclonal Antibody to HOXA9

details-Polyclonal Antibody to HOXA9
Anti-Human CD243 APC (Clone : UIC2)

Anti-Human CD243 APC (Clone : ...

details-Anti-Human CD243 APC (Clone : UIC2)
Anti-BCMA antibody(DM4), Rabbit mAb

Anti-BCMA antibody(DM4), Rabbi...

details-Anti-BCMA antibody(DM4), Rabbit mAb

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

FTSJ2 Recombinant Protein

FTSJ2 Recombinant Protein

HAX1 Recombinant Protein

HAX1 Recombinant Protein

Recombinant S. cerevisiae TIM14

Recombinant S. cerevisiae TIM14

New Products

Anti-Hu CD316 PE Mab(8A12)

Anti-Hu CD316 PE Mab(8A12)

Anti-CD325 PE Mab(8C11)

Anti-CD325 PE Mab(8C11)

Human BACE1 Protein, His Tag

Human BACE1 Protein, His Tag

close

Please Login to write a Review !!


close

Recombinant Mouse Myostatin/MSTN/GDF-8 (C-6His)(Discontinued)

Product code: 32-7638
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart