Recombinant Human Corticotropin-Releasing Factor-Binding Protein/CRHBP (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGLVDHHHHHH |
Source: Human Cells.
MW :34.38kD.
Recombinant Human CRHBP is produced by our Mammalian expression system and the target gene encoding Tyr25-Leu322 is expressed with a 6His tag at the C-terminus. Corticotropin-Releasing Factor-Binding Protein (CRHBP) is a 37 kDa secreted glycoprotein that binds both CRH and urocortin in a 42 kDa extracellular complex. The molecule is approximately 300 amino acids in length and demonstrates five intrachain disulfide bonds. Difference between CRHBP from different species exist, human CRHBP is found in plasma while rodent and sheep CRHBP is limited to neuroendocrine tissues. CRHBP may inactivate CRH and may prevent inappropriate pituitary-adrenal stimulation in pregnancy. CRHBP is presumed to either sequester CRH, rendering it unavailable to cells or transport it to target tissues. Although CRF-BP concentration in the human peripheral circulation is normally low, it increases throughout pregnancy and fall back rapidly after parturition.
MW :34.38kD.
Recombinant Human CRHBP is produced by our Mammalian expression system and the target gene encoding Tyr25-Leu322 is expressed with a 6His tag at the C-terminus. Corticotropin-Releasing Factor-Binding Protein (CRHBP) is a 37 kDa secreted glycoprotein that binds both CRH and urocortin in a 42 kDa extracellular complex. The molecule is approximately 300 amino acids in length and demonstrates five intrachain disulfide bonds. Difference between CRHBP from different species exist, human CRHBP is found in plasma while rodent and sheep CRHBP is limited to neuroendocrine tissues. CRHBP may inactivate CRH and may prevent inappropriate pituitary-adrenal stimulation in pregnancy. CRHBP is presumed to either sequester CRH, rendering it unavailable to cells or transport it to target tissues. Although CRF-BP concentration in the human peripheral circulation is normally low, it increases throughout pregnancy and fall back rapidly after parturition.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 107783. 13 interactions. |
|
There are currently no product reviews
|









.png)











