Recombinant Human Coxsackievirus and Adenovirus Receptor/CAR/CXADR (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGVDHHHHHH |
Source: Human Cells.
MW :25.08kD.
Recombinant Human Coxsackievirus and Adenovirus Receptor is produced by our Mammalian expression system and the target gene encoding Leu20-Gly237 is expressed with a 6His tag at the C-terminus. Coxsackievirus and Adenovirus Receptor (CAR) belongs to the CTX family of the Ig superfamily. CXADR is a type I transmembrane glycoprotein and expressed in pancreas, brain, heart, small intestine, testis, prostate. It is a receptor that mediates gene transfer and also act as an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs. CXADR contains an extracellular domain, a transmembrane helix and a C-terminal intracellular domain. The C-terminal interacts with few cytoplasmic junctional proteins, microtubules and the actin cytoskeleton.
MW :25.08kD.
Recombinant Human Coxsackievirus and Adenovirus Receptor is produced by our Mammalian expression system and the target gene encoding Leu20-Gly237 is expressed with a 6His tag at the C-terminus. Coxsackievirus and Adenovirus Receptor (CAR) belongs to the CTX family of the Ig superfamily. CXADR is a type I transmembrane glycoprotein and expressed in pancreas, brain, heart, small intestine, testis, prostate. It is a receptor that mediates gene transfer and also act as an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs. CXADR contains an extracellular domain, a transmembrane helix and a C-terminal intracellular domain. The C-terminal interacts with few cytoplasmic junctional proteins, microtubules and the actin cytoskeleton.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Palmitoylated on Cys-259 and/or Cys-260; required for proper localization to the plasma membrane. |
| Tissue Specificity: | Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromuscular junction and isoform 2 is found in blood vessels. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. In heart expressed in subendothelial layers of the vessel wall but not in the luminal endothelial surface. Expression is elevated in hearts with dilated cardiomyopathy. |
| BioGrid: | 107905. 18 interactions. |
|
There are currently no product reviews
|



















.png)









