Recombinant Human Signal Transducer and Activator of Transcription 6/STAT6 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSLEHHHHHH |
Source: E. coli.
MW :23.9kD.
Recombinant Human STAT6 is produced by our E.coli expression system and the target gene encoding Ser627-Ser837 is expressed with a 6His tag at the C-terminus. Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the STAT family of transcription factors. At least seven STATs exist: STAT1, 2, 3, 4, 5a, 5b, and 6. They are responsible for an array of cellular activities including regulating growth, survival, differentiation, motility, and the immune response. STAT6 plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. STAT6 has been shown to interact with EP300, CREB-binding protein, NFKB1, Nuclear receptor coactivator 1, IRF4 and SND1.
MW :23.9kD.
Recombinant Human STAT6 is produced by our E.coli expression system and the target gene encoding Ser627-Ser837 is expressed with a 6His tag at the C-terminus. Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the STAT family of transcription factors. At least seven STATs exist: STAT1, 2, 3, 4, 5a, 5b, and 6. They are responsible for an array of cellular activities including regulating growth, survival, differentiation, motility, and the immune response. STAT6 plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. STAT6 has been shown to interact with EP300, CREB-binding protein, NFKB1, Nuclear receptor coactivator 1, IRF4 and SND1.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Post transnational modification: | Mono-ADP-ribosylated by PARP14. |
| BioGrid: | 112655. 61 interactions. |
|
There are currently no product reviews
|



















.png)










