Recombinant Human Cyclin-Dependent Kinase 7/CDK7 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM PB,100mM NaCl,5mM DTT,20%Glycerol pH7.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Source: E. coli.
MW :41.2kD.
Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E.coli expression system and the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus. Cyclin-dependent kinase 7 (CDK7) belongs to the CMGC Ser/Thr superfamily, CDK7 colocalizes with PRKCI in the cytoplasm and nucleus, translocating from the nucleus to cytoplasm and perinuclear region in response to DNA-bound peptides. As a serine/threonine kinase CDK7 is involved in cell cycle control and RNA polymerase II-mediated RNA transcription. In addition, CDK7 is the catalytic subunit of the CDK-activating kinase complex, which phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11.
MW :41.2kD.
Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E.coli expression system and the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus. Cyclin-dependent kinase 7 (CDK7) belongs to the CMGC Ser/Thr superfamily, CDK7 colocalizes with PRKCI in the cytoplasm and nucleus, translocating from the nucleus to cytoplasm and perinuclear region in response to DNA-bound peptides. As a serine/threonine kinase CDK7 is involved in cell cycle control and RNA polymerase II-mediated RNA transcription. In addition, CDK7 is the catalytic subunit of the CDK-activating kinase complex, which phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Cytoplasm |
| Post transnational modification: | Phosphorylation of Ser-164 during mitosis inactivates the enzyme. Phosphorylation of Thr-170 is required for activity. Phosphorylated at Ser-164 and Thr-170 by CDK2. |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 107457. 86 interactions. |
|
There are currently no product reviews
|
















.png)








