Recombinant Human Cystatin A (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
Source: E.coli.
MW :11.8kD.
Recombinant Human Cystatin A is produced by our E.coli expression system and the target gene encoding Ile2-Phe98 is expressed with a 6His tag at the N-terminus. Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways.
MW :11.8kD.
Recombinant Human Cystatin A is produced by our E.coli expression system and the target gene encoding Ile2-Phe98 is expressed with a 6His tag at the N-terminus. Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Expressed in the skin throughout the epidermis. |
| BioGrid: | 107857. 33 interactions. |
|
There are currently no product reviews
|













.png)








