Recombinant Human Cystatin SN/CST1 (C-6His)

Product code: 32-7416

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQESVDHHHHHH
Gene : CST1
Gene ID : 1469
Uniprot ID : P01037
Source: Human Cells.
MW :15.35kD.
Recombinant Human Cystatin SN is produced by our Mammalian expression system and the target gene encoding Trp21-Ser141 is expressed with a 6His tag at the C-terminus. Cystatin-SN is a member of family 2 of the Cystatin superfamily and a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. Together with Cystatins S and SA, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin-SN inhibits members of the Papain family including Cathepsins B, C, H and L.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Tissue Specificity: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
BioGrid: 107851. 38 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products