Recombinant Human Fibroblast Growth Factor 23/FGF-23 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIVDHHHHHH |
Source: Human Cells.
MW :26.4kD.
Recombinant Human Fibroblast Growth Factor 23 is produced by our Mammalian expression system and the target gene encoding Tyr25-Ile251 is expressed with a 6His tag at the C-terminus. Fibroblast Growth Factor 23 (FGF-23) is a secreted protein that belongs to the heparin-binding growth factors family. FGF-23 is expressed in osteogenic cells, particularly during phases of active bone remodeling. FGF family members possess broad mitogenic and cell survival activities, involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF-23 regulates homeostasis of phosphate and vitamin-D metabolism. FGF-23 inhibits renal tubular phosphate transport by reducing SLC34A1 levels, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 also upregulates EGR1 expression in the presence of KL, acts directly on the parathyroid to decrease PTH secretion. Defects in FGF-23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR).
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | O-glycosylated by GALT3. Glycosylation is necessary for secretion; it blocks processing by proprotein convertases when the O-glycan is alpha 2,6-sialylated. Competition between proprotein convertase cleavage and block of cleavage by O-glycosylation determines the level of secreted active FGF23. |
| Tissue Specificity: | Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). |
| BioGrid: | 113748. 2 interactions. |
|
There are currently no product reviews
|

















.png)






