Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Fibroblast Growth Factor 23/FGF-23 (C-6His)(Discontinued)

Recombinant Human Fibroblast Growth Factor 23/FGF-23 (C-6His)(Discontinued)

Share:

Recombinant Human Fibroblast Growth Factor 23/FGF-23 (C-6His)(Discontinued)

Roll over image to zoom in

   

Product code: 32-7751

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIVDHHHHHH
Gene : FGF23
Gene ID : 8074
Uniprot ID : Q9GZV9

Source: Human Cells.
MW :26.4kD.
Recombinant Human Fibroblast Growth Factor 23 is produced by our Mammalian expression system and the target gene encoding Tyr25-Ile251 is expressed with a 6His tag at the C-terminus. Fibroblast Growth Factor 23 (FGF-23) is a secreted protein that belongs to the heparin-binding growth factors family. FGF-23 is expressed in osteogenic cells, particularly during phases of active bone remodeling. FGF family members possess broad mitogenic and cell survival activities, involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF-23 regulates homeostasis of phosphate and vitamin-D metabolism. FGF-23 inhibits renal tubular phosphate transport by reducing SLC34A1 levels, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 also upregulates EGR1 expression in the presence of KL, acts directly on the parathyroid to decrease PTH secretion. Defects in FGF-23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR).

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: O-glycosylated by GALT3. Glycosylation is necessary for secretion; it blocks processing by proprotein convertases when the O-glycan is alpha 2,6-sialylated. Competition between proprotein convertase cleavage and block of cleavage by O-glycosylation determines the level of secreted active FGF23.
Tissue Specificity: Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts).
BioGrid: 113748. 2 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-OX40 (ivuxolimab biosimilar) mAb

Anti-OX40 (ivuxolimab biosimil...

details-Anti-OX40 (ivuxolimab biosimilar) mAb
Anti-Mouse CD26 PE (Clone : H194-112)

Anti-Mouse CD26 PE (Clone : H1...

details-Anti-Mouse CD26 PE (Clone : H194-112)
Anti-GITR/TNFRSF18 (ragifilimab) mAb

Anti-GITR/TNFRSF18 (ragifilima...

details-Anti-GITR/TNFRSF18 (ragifilimab) mAb
Anti-Mouse CD2 Antibody (Clone : RM2-5)

Anti-Mouse CD2 Antibody (Clone...

details-Anti-Mouse CD2 Antibody (Clone : RM2-5)
SARS-CoV-2 Nucleocapsid Antibody (Clone: 3C6)

SARS-CoV-2 Nucleocapsid Antibo...

details-SARS-CoV-2 Nucleocapsid Antibody (Clone: 3C6)
FETUB Recombinant Protein

FETUB Recombinant Protein

details-FETUB Recombinant Protein
Recombinant Porcine Trypsin

Recombinant Porcine Trypsin

details-Recombinant Porcine Trypsin
Anti-Human CD100 Antibody (Clone : 133-1C6)

Anti-Human CD100 Antibody (Clo...

details-Anti-Human CD100 Antibody (Clone : 133-1C6)
Apo Transferrin Native Protein

Apo Transferrin Native Protein

details-Apo Transferrin Native Protein
Anti-Human SUSD2 Antibody (Clone : W5C5)

Anti-Human SUSD2 Antibody (Clo...

details-Anti-Human SUSD2 Antibody (Clone : W5C5)
Anti-Cytokeratin (Pan-reactive) Monoclonal Antibody (Clone:C-11)

Anti-Cytokeratin (Pan-reactive...

details-Anti-Cytokeratin (Pan-reactive) Monoclonal Antibody (Clone:C-11)
Anti-CD2 Monoclonal Antibody (Clone:IHC531)

Anti-CD2 Monoclonal Antibody (...

details-Anti-CD2 Monoclonal Antibody (Clone:IHC531)
Anti-SARS-CoV-2 Nucleocapsid antibody(DM37), Rabbit mAb

Anti-SARS-CoV-2 Nucleocapsid a...

details-Anti-SARS-CoV-2 Nucleocapsid antibody(DM37), Rabbit mAb
Anti-IL-4RA (dupilumab biosimilar) mAb

Anti-IL-4RA (dupilumab biosimi...

details-Anti-IL-4RA (dupilumab biosimilar) mAb

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Human Epidermal Growth Factor

Human Epidermal Growth Factor

Recombinant Human Netrin-G1/NTNG1 (C-6His)

Recombinant Human Netrin-G1/NTNG1 (C-6His)

Recombinant Human Phospholipid Scramblase 3

Recombinant Human Phospholipid Scramblase 3

New Products

CoV-2 Omicron

CoV-2 Omicron

Recombinant Human Inhibitor of growth protein 5(C-His)

Recombinant Human Inhibitor of growth protein 5(C-His)

Recombinant Human TP53-binding protein 1 (C-His)

Recombinant Human TP53-binding protein 1 (C-His)

close

Please Login to write a Review !!


close

Recombinant Human Fibroblast Growth Factor 23/FGF-23 (C-6His)(Discontinued)

Product code: 32-7751
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart