Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)(Discontinued)
M: Marker, Lane 1: Sample in reducing conditions, Lane 2: Sample in non-reducing conditions
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Purification : | Greater than 95% as determined by reducing SDS-PAGE. Endotoxin less than 0.1 ng/ug as determined by LAL test |
| Content : | 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Store at -20C , Stable for 6 months. Minimize freeze -thaw cycle. |
| AA sequence : | Recombinant Human Fibronectin is produced by our E.coli expression system and the target gene encoding Glu5-Thr95 is expressed with a 6His, Avi tag at the N-terminus. Sequence:MNHKVHHHHHHMGLNDIFEAQKIEWHEGGGGSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT |
| Uniprot ID : | P02751 |
| Alternative Name : | Fibronectin; FN1 |
Source : E. coli;
Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Similar to integrins, fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans. Fibronectin plays a major role in cell adhesion, growth, migration, and differentiation, and it is important for processes such as wound healing and embryonic development. Altered fibronectin expression, degradation, and organization has been associated with a number of pathologies, including cancer and fibrosis. Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.
|
There are currently no product reviews
|












.png)








