Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

    Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

    Share:

    M: Marker, Lane 1: Sample in reducing conditions, Lane 2: Sample in non-reducing conditions

    Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

    Roll over image to zoom in

       

    Product code: 32-9541

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   500 µg

    •  50 µg

    • $1,150.00 

    • $380.00  $304.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Review   (0)
    Amount : 50 µg
    Purification : Greater than 95% as determined by reducing SDS-PAGE. Endotoxin less than 0.1 ng/ug as determined by LAL test
    Content : 0.2 µm filtered solution of PBS, pH7.4.
    Storage condition : Store at -20C , Stable for 6 months. Minimize freeze -thaw cycle.
    AA sequence : Recombinant Human Fibronectin is produced by our E.coli expression system and the target gene encoding Glu5-Thr95 is expressed with a 6His, Avi tag at the N-terminus. Sequence:MNHKVHHHHHHMGLNDIFEAQKIEWHEGGGGSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
    Uniprot ID : P02751
    Alternative Name : Fibronectin; FN1

    Source : E. coli;
    Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Similar to integrins, fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans. Fibronectin plays a major role in cell adhesion, growth, migration, and differentiation, and it is important for processes such as wound healing and embryonic development. Altered fibronectin expression, degradation, and organization has been associated with a number of pathologies, including cancer and fibrosis. Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-Cytokeratin 7+17 Monoclonal Antibody (Clone:C-46)

    Anti-Cytokeratin 7+17 Monoclon...

    details-Anti-Cytokeratin 7+17 Monoclonal Antibody (Clone:C-46)
    Monoclonal Antibody to mouse Ly-6C

    Monoclonal Antibody to mouse L...

    details-Monoclonal Antibody to mouse Ly-6C
    Recombinant 2019-nCoV S Protein RBD (E484K, Mammalian, C-His)

    Recombinant 2019-nCoV S Protei...

    details-Recombinant 2019-nCoV S Protein RBD (E484K, Mammalian, C-His)
    Anti-Mouse CD16/CD32 FITC (Clone : 93)

    Anti-Mouse CD16/CD32 FITC (Clo...

    details-Anti-Mouse CD16/CD32 FITC (Clone : 93)
    Anti-GATA3 Monoclonal Antibody (Clone:IHC583)

    Anti-GATA3 Monoclonal Antibody...

    details-Anti-GATA3 Monoclonal Antibody (Clone:IHC583)
    Anti-CTLA-4 Monoclonal Antibody (Clone:IHC004)

    Anti-CTLA-4 Monoclonal Antibod...

    details-Anti-CTLA-4 Monoclonal Antibody (Clone:IHC004)
    Anti-Gamma-tubulin complex component 2 Monoclonal Antibody (Clone:GCP2-01)

    Anti-Gamma-tubulin complex com...

    details-Anti-Gamma-tubulin complex component 2 Monoclonal Antibody (Clone:GCP2-01)
    Anti-Mouse CD106 FITC (Clone : 429 (MVCAM.A))

    Anti-Mouse CD106 FITC (Clone :...

    details-Anti-Mouse CD106 FITC (Clone : 429 (MVCAM.A))
    Annexin V-FITC Apoptosis Detection Kit

    Annexin V-FITC Apoptosis Detec...

    details-Annexin V-FITC Apoptosis Detection Kit
    Recombinant human TM4SF1 protein with C-terminal human Fc tag

    Recombinant human TM4SF1 prote...

    details-Recombinant human TM4SF1 protein with C-terminal human Fc tag
    oLeptin tA PEG Recombinant Protein

    oLeptin tA PEG Recombinant Pro...

    details-oLeptin tA PEG Recombinant Protein
    Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) Alkaline Phosphatase(Discontinued)

    Anti-HSP90 beta Monoclonal Ant...

    details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) Alkaline Phosphatase(Discontinued)
    Anti-MSH2 Monoclonal Antibody (Clone:IHC410)

    Anti-MSH2 Monoclonal Antibody ...

    details-Anti-MSH2 Monoclonal Antibody (Clone:IHC410)
    Mouse IgG2a Isotype Control DyLight<sup>®</sup> 488 (Clone : MOPC-173)

    Mouse IgG2a Isotype Control Dy...

    details-Mouse IgG2a Isotype Control DyLight<sup>®</sup> 488 (Clone : MOPC-173)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)

    Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)

    Recombinant Mouse TWEAK Receptor/TWEAK R/TNFRSF12A (C-Fc)

    Recombinant Mouse TWEAK Receptor/TWEAK R/TNFRSF12A (C-Fc)

    CEBP-g Recombinant Protein

    CEBP-g Recombinant Protein

    close

    Please Login to write a Review !!


    close

    Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

    Product code: 32-9541
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart