Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

Share:

M: Marker, Lane 1: Sample in reducing conditions, Lane 2: Sample in non-reducing conditions

Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

Roll over image to zoom in

   

Product code: 32-9541

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   500 µg

  •  50 µg

  • $1,203.00 

  • $468.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 50 µg
Purification : Greater than 95% as determined by reducing SDS-PAGE. Endotoxin less than 0.1 ng/ug as determined by LAL test
Content : 0.2 µm filtered solution of PBS, pH7.4.
Storage condition : Store at -20C , Stable for 6 months. Minimize freeze -thaw cycle.
AA sequence : Recombinant Human Fibronectin is produced by our E.coli expression system and the target gene encoding Glu5-Thr95 is expressed with a 6His, Avi tag at the N-terminus. Sequence:MNHKVHHHHHHMGLNDIFEAQKIEWHEGGGGSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
Uniprot ID : P02751
Alternative Name : Fibronectin; FN1

Source : E. coli;
Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Similar to integrins, fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans. Fibronectin plays a major role in cell adhesion, growth, migration, and differentiation, and it is important for processes such as wound healing and embryonic development. Altered fibronectin expression, degradation, and organization has been associated with a number of pathologies, including cancer and fibrosis. Anastellin binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Recombinant human ANPEP protein with C-terminal human Fc tag

Recombinant human ANPEP protei...

details-Recombinant human ANPEP protein with C-terminal human Fc tag
Recombinant human NKG2D protein with N-terminal mouse Fc

Recombinant human NKG2D protei...

details-Recombinant human NKG2D protein with N-terminal mouse Fc
Recombinant human IL4RA protein with C-terminal human Fc tag

Recombinant human IL4RA protei...

details-Recombinant human IL4RA protein with C-terminal human Fc tag
Recombinant human 4-1BB protein with C-terminal 6×His tag

Recombinant human 4-1BB protei...

details-Recombinant human 4-1BB protein with C-terminal 6×His tag
Recombinant Human IgG1-Fc Protein

Recombinant Human IgG1-Fc Prot...

details-Recombinant Human IgG1-Fc Protein
Recombinant human IL1R1 protein with C-terminal human Fc tag

Recombinant human IL1R1 protei...

details-Recombinant human IL1R1 protein with C-terminal human Fc tag
Recombinant human CCR2 protein with C-terminal human Fc tag

Recombinant human CCR2 protein...

details-Recombinant human CCR2 protein with C-terminal human Fc tag
Recombinant Human CD162 protein with C-terminal 6×His tag

Recombinant Human CD162 protei...

details-Recombinant Human CD162 protein with C-terminal 6×His tag
Recombinant human IL17B protein with C-terminal human Fc tag

Recombinant human IL17B protei...

details-Recombinant human IL17B protein with C-terminal human Fc tag
Recombinant human C5AR1 protein with C-terminal human Fc tag

Recombinant human C5AR1 protei...

details-Recombinant human C5AR1 protein with C-terminal human Fc tag
Recombinant human B7-2 protein with C-terminal mouse Fc and 6×His tag

Recombinant human B7-2 protein...

details-Recombinant human B7-2 protein with C-terminal mouse Fc and 6×His tag
Recombinant human TNFRSF11A protein with C-terminal human Fc tag

Recombinant human TNFRSF11A pr...

details-Recombinant human TNFRSF11A protein with C-terminal human Fc tag
Recombinant TLR5 Protein with human Fc Tag

Recombinant TLR5 Protein with ...

details-Recombinant TLR5 Protein with human Fc Tag
Recombinant human VEGFR2 Protein with C-terminal 6×His tag

Recombinant human VEGFR2 Prote...

details-Recombinant human VEGFR2 Protein with C-terminal 6×His tag

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant Human YY1 Transcription Factor

Recombinant Human YY1 Transcription Factor

Recombinant human CLDN3 protein with C-terminal human Fc tag

Recombinant human CLDN3 protein with C-terminal human Fc tag

Recombinant Mouse Leucine-rich Repeats and IG-like Domains Protein 1/LRIG1 (C-6His)

Recombinant Mouse Leucine-rich Repeats and IG-like Domains Protein 1/LRIG1 (C-6His)

New Products

Anti-Human CD158z MAb(Clone :CH21)

Anti-Human CD158z MAb(Clone :CH21)

Anti-Human IgE APC MAb(Clone :4H10)

Anti-Human IgE APC MAb(Clone :4H10)

Anti-Human CD369 APC  MAb(Clone :15E2)

Anti-Human CD369 APC MAb(Clone :15E2)

close

Please Login to write a Review !!


close

Recombinant Human Fibronectin ED-B domain (N-Avi-His)(biotinylation)

Product code: 32-9541
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart