Recombinant Human Glia Maturation Factor beta/GMF- beta/GMFB (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,200mMNaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFHLEHHHHHH |
Source: E. coli.
MW :17.7kD.
Recombinant Human Glia maturation factor beta is produced by our E.coli expression system and the target gene encoding Met1-His142 is expressed with a 6His tag at the C-terminus. Glia maturation factor beta (GMFB) contains a ADF-H domain,which is a member of the actin-binding proteins ADF family, GMF subfamily. It is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. GMFB causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. It is phosphorylated after phorbol ester stimulation, and is crucial for the nervous system. GMFB overexpression in astrocytes results in the increase of BDNF production. GMFB expression is increased by exercise, thus BDNF is important for exercise-induction of BDNF.
MW :17.7kD.
Recombinant Human Glia maturation factor beta is produced by our E.coli expression system and the target gene encoding Met1-His142 is expressed with a 6His tag at the C-terminus. Glia maturation factor beta (GMFB) contains a ADF-H domain,which is a member of the actin-binding proteins ADF family, GMF subfamily. It is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. GMFB causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. It is phosphorylated after phorbol ester stimulation, and is crucial for the nervous system. GMFB overexpression in astrocytes results in the increase of BDNF production. GMFB expression is increased by exercise, thus BDNF is important for exercise-induction of BDNF.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Phosphorylated; stimulated by phorbol ester. |
| BioGrid: | 109026. 16 interactions. |
|
There are currently no product reviews
|










.png)












