Recombinant Human Golgi Membrane Protein 1/GOLM1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLVDHHHHHH |
Source: Human Cells.
MW :42.6kD.
Recombinant Human Golgi Membrane Protein 1/ is produced by our Mammalian expression system and the target gene encoding Ser35-Leu400 is expressed with a 6His tag at the C-terminus. Golgi Membrane Protein 1 (GOLM1) belongs to the GOLM1/CASC4 family, GOLM1 is a single-pass type II membrane protein and can be found in many tissues . GOLM1 is overexpressed in prostate cancer and lung adenocarcinoma tissue. GOLM1 can be up-regulated in response to viral infection. GOLM1 is induced by the E1A adenoviral protein. GOLM1 plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum.
MW :42.6kD.
Recombinant Human Golgi Membrane Protein 1/ is produced by our Mammalian expression system and the target gene encoding Ser35-Leu400 is expressed with a 6His tag at the C-terminus. Golgi Membrane Protein 1 (GOLM1) belongs to the GOLM1/CASC4 family, GOLM1 is a single-pass type II membrane protein and can be found in many tissues . GOLM1 is overexpressed in prostate cancer and lung adenocarcinoma tissue. GOLM1 can be up-regulated in response to viral infection. GOLM1 is induced by the E1A adenoviral protein. GOLM1 plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus |
| Post transnational modification: | Phosphorylation sites are present in the extracellular medium. |
| Tissue Specificity: | Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocytes-derived syncytial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes. |
| BioGrid: | 119432. 38 interactions. |
|
There are currently no product reviews
|










.png)










