Recombinant Human Heme Oxygenase 1/HO-1

Product code: 32-7127

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $579.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT
Gene : HMOX1
Gene ID : 3162
Uniprot ID : P09601
Source: E.coli.
MW :29.86kD.
Recombinant Human Heme Oxygenase 1 is produced by our E.coli expression system and the target gene encoding Met1-Thr261 is expressed. Heme Oxygenase 1 (HO-1) is an enzyme in endoplasmic reticulum that belongs to the heme oxygenase family. HO-1 cleaves the heme ring at the alpha methene bridge to form Biliverdin. Biliverdin is subsequently converted to Bilirubin by Biliverdin reductase. In physiological state, the highest activity of HO-1 is found in the spleen, where senescent erythrocytes are sequestrated and destroyed. HO-1 activity is highly inducible by its substrate heme and by various non-heme substances such as heavy metals, bromobenzene, endotoxin, oxidizing agents and UVA. HO-1 is involved in the regulation of cardiovascular function and response to a variety of stressors. Defects in HO-1 are the cause of Heme Oxygenase 1 deficiency, resulting in marked erythrocyte fragmentation and intravascular hemolysis, coagulation abnormalities, endothelial damage, and iron deposition in renal and hepatic tissues.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Microsome, Endoplasmic reticulum membrane
Tissue Specificity: Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).
BioGrid: 109405. 36 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products