Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Purification : | Greater than 95.0% as determined by SDS-PAGE. |
| Content : | The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. |
| Storage condition : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| AA sequence : | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL. |
| Alternative Name : | P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein,Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543. |
Source : Escherichia Coli.
Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.
RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|















.png)










