Recombinant Human Hemoglobin Subunit Zeta/HBAZ (N-6His)

Product code: 32-7209

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Gene : HBZ
Gene ID : 3050
Uniprot ID : P02008
Source: E.coli.
MW :17.8kD.
Recombinant Human Hemoglobin Subunit Zeta is produced by our E.coli expression system and the target gene encoding Met1-Arg142 is expressed with a 6His tag at the N-terminus. Hemoglobin Subunit Zeta (HBZ) is a member of the Globin family. The zeta chain is an alpha-type chain of mammalian embryonic Hemoglobin that is synthesized primarily in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal growth and adult life. The HBZ gene consists of five functional genes and two pseudogenes, the order of genes is 5-zeta-pseudozeta-mu-pseudoalpha-1-alpha-2-alpha-1-theta-1-3.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Tissue Specificity: Detected in fetal erythrocytes (at protein level).
BioGrid: 109300. 23 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products