Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF(C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLHHHHHH |
Source: Human Cells.
MW :15.1kD.
Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus. Heparin-binding EGF-like growth factor (HB-EGF) is a 12Â16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGFÂlike domain, and a heparin-binding motif. Mature HBÂEGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HBÂEGF shows 76% and 73% aa sequence identity with rat and mouse HBÂEGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HBÂEGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to nonÂmitogenic actions, while EGFR binding induces both mitogenic and nonÂmitogenic activity.
MW :15.1kD.
Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus. Heparin-binding EGF-like growth factor (HB-EGF) is a 12Â16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGFÂlike domain, and a heparin-binding motif. Mature HBÂEGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HBÂEGF shows 76% and 73% aa sequence identity with rat and mouse HBÂEGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HBÂEGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to nonÂmitogenic actions, while EGFR binding induces both mitogenic and nonÂmitogenic activity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | O-glycosylated with core 1 or possibly core 8 glycans. Thr-47 is a minor glycosylation site compared to Thr-44. |
| BioGrid: | 108172. 9 interactions. |
|
There are currently no product reviews
|

















.png)











