Recombinant Human ICOS/CRP-1/AILIM/CD278 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 . |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
MW :40.8kD.
Recombinant Human Inducible T-cell costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Phe141 is expressed with a Fc tag at the C-terminus. Inducible T-cell costimulator, also known as activation-inducible lymphocyte immunomediatory molecule, CD278, AILIM, CVID1 and ICOS, belongs to the CD28 and CTLA4 cell surface receptor family.. ICOS contains one Ig-like V-type domain and exsits as a homodimer with disulfide-linked. ICOS is highly expressed on tonsillar T-cellsand can be induced by PMA and ionomycin, ICOS plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. Defects in ICOS are the cause of immunodeficiency common variable type 1, which is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antige
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | N-glycosylated. |
Tissue Specificity: | Activated T-cells. Highly expressed on tonsillar T-cells, which are closely associated with B-cells in the apical light zone of germinal centers, the site of terminal B-cell maturation. Expressed at lower levels in thymus, lung, lymph node and peripheral blood leukocytes. Expressed in the medulla of fetal and newborn thymus. |
BioGrid: | 118933. 10 interactions. |
There are currently no product reviews
|