Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 (C-6His, N-T7 tag)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH |
Source: E. coli.
MW :27.2kD.
Recombinant Human IGF2BP2 is produced by our E.coli expression system and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Insulin-Like Growth Factor 2 mRNA-Binding Protein 2 (IGFBP2) belongs to the RRM IMP/VICKZ family. IGFBP2 is a cytoplasmic protein and contains four KH domains and two RRM (RNA recognition motif) domains. IGF2BP2 binds to the 5'-UTR of the Insulin-Like Growth Factor 2 (IGF2) mRNA. This binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs. Genetic variation at the IGF2BP2 gene has been associated with type 2 diabetes (T2D) by genome-wide association studies and by replication analyses.
MW :27.2kD.
Recombinant Human IGF2BP2 is produced by our E.coli expression system and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Insulin-Like Growth Factor 2 mRNA-Binding Protein 2 (IGFBP2) belongs to the RRM IMP/VICKZ family. IGFBP2 is a cytoplasmic protein and contains four KH domains and two RRM (RNA recognition motif) domains. IGF2BP2 binds to the 5'-UTR of the Insulin-Like Growth Factor 2 (IGF2) mRNA. This binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs. Genetic variation at the IGF2BP2 gene has been associated with type 2 diabetes (T2D) by genome-wide association studies and by replication analyses.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm |
| Tissue Specificity: | Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bone marrow, colon, kidney, salivary glands, testis and pancreas. Detected in fetal liver, fetal ovary, gonocytes and interstitial cells of the testis. |
| BioGrid: | 115888. 47 interactions. |
|
There are currently no product reviews
|













.png)












