Recombinant Human IL-21 Receptor/IL-21R (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPVDHHHHHH |
MW :26kD.
Recombinant Human Interleukin-21 Receptor is produced by our Mammalian expression system and the target gene encoding Cys20-Pro236 is expressed with a 6His tag at the C-terminus. Interleukin-21 receptor is also known as IL-21 receptor, IL-21R, CD360. In humans, it is encoded by the IL21R gene. It belongs to the type I cytokine receptor family. Type 4 subfamily contains 2 fibronectin type-III domains. Interleukin-21 receptor is selectively expressed in lymphoid tissues and highly expressed in thymus and spleen. IL-21 is produced by CD4+ T cells in response to antigenic stimulation. Its action enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells. It also promotes the anti-tumor activity of CD8+ T-cells and NK cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Membrane |
Post transnational modification: | C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame. |
Tissue Specificity: | Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen. |
BioGrid: | 119095. 2 interactions. |
There are currently no product reviews
|