Recombinant Human Interleukin-17B/IL-17B (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIFDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
MW :45.1kD.
Recombinant Human Interleukin-17B is produced by our Mammalian expression system and the target gene encoding Gln21-Phe180 is expressed with a Fc tag at the C-terminus. Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Tissue Specificity: | Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary. |
BioGrid: | 118065. 25 interactions. |
There are currently no product reviews
|