Recombinant Human Protein Disulfide-Isomerase A5/PDIA5 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of PBS,pH7.4. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPLVDHHHHHH |
Source: Human Cells.
MW :28.8kD.
Recombinant Human Protein disulfide-isomerase A5 is produced by our Mammalian expression system and the target gene encoding Ser22-Leu262 is expressed with a 6His tag at the C-terminus. Protein disulfide-isomerase A5 is a 519 amino acids protein that belongs to the protein disulfide isomerase family.It contains 3 thioredoxin domains.It can catalyze the rearrangement of -S-S- bonds in proteins.
MW :28.8kD.
Recombinant Human Protein disulfide-isomerase A5 is produced by our Mammalian expression system and the target gene encoding Ser22-Leu262 is expressed with a 6His tag at the C-terminus. Protein disulfide-isomerase A5 is a 519 amino acids protein that belongs to the protein disulfide isomerase family.It contains 3 thioredoxin domains.It can catalyze the rearrangement of -S-S- bonds in proteins.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Endoplasmic reticulum lumen |
BioGrid: | 116154. 42 interactions. |
There are currently no product reviews
|