Recombinant Human Interleukin-35/IL-35 (C-Fc)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :73.9kD.
Recombinant Human Interleukin-35 is produced by our Mammalian expression system and the target gene encoding Arg21-Lys229&Arg23-Ser219 is expressed with a Fc tag at the C-terminus. Interleukin-35 is a newest and potent suppressive cytokine of the IL-12 family. Unlike other members of the IL-12 family which are produced mainly by antigen-presenting cells (APCs), IL-35 has been identified as a potentially immunosuppressive cytokine primarily produced by regulatory T (Treg) cells, and to a lesser extent by activated dendritic cells and macrophages. IL-35 is composed of the IL-12 p35 subunit and the IL-27 Epstein–Barr virus-induced protein 3 (EBI3) subunit. IL-35 plays an important role in many disease models and has been recently shown to have additional functions aside from inhibition of proliferation, including inducing its own expression in non-Treg cells.
MW :73.9kD.
Recombinant Human Interleukin-35 is produced by our Mammalian expression system and the target gene encoding Arg21-Lys229&Arg23-Ser219 is expressed with a Fc tag at the C-terminus. Interleukin-35 is a newest and potent suppressive cytokine of the IL-12 family. Unlike other members of the IL-12 family which are produced mainly by antigen-presenting cells (APCs), IL-35 has been identified as a potentially immunosuppressive cytokine primarily produced by regulatory T (Treg) cells, and to a lesser extent by activated dendritic cells and macrophages. IL-35 is composed of the IL-12 p35 subunit and the IL-27 Epstein–Barr virus-induced protein 3 (EBI3) subunit. IL-35 plays an important role in many disease models and has been recently shown to have additional functions aside from inhibition of proliferation, including inducing its own expression in non-Treg cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 115450. 11 interactions. |
|
There are currently no product reviews
|












.png)







