Recombinant Human Kallikrein 11/KLK11 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNNVDHHHHHH |
Source: Human Cells.
MW :26.28kD.
Recombinant Human Kallikrein 11 is produced by our Mammalian expression system and the target gene encoding Glu19-Asn250 is expressed with a 6His tag at the C-terminus. Human Kallikrein 11 (KLK11) is a member of tissue kallikrein family which are extracellular serine proteases consisting of 15 members. Two isoforms of KLK11 are differentially expressed. Isoform 1 is predominantly expressed in brain and isoform 2 is preferentially expressed in prostate. Isoform 1 consists of a signal peptide,a short pro peptide and the mature chain.Isoform 2 contains an extra 32 amino acid N terminal to full-length isoform 1.KLK11 is a novel marker for ovarian and prostate cancer carcinomas. KLK11 can be activated by thermolysin and is active against a thioester substrate.
MW :26.28kD.
Recombinant Human Kallikrein 11 is produced by our Mammalian expression system and the target gene encoding Glu19-Asn250 is expressed with a 6His tag at the C-terminus. Human Kallikrein 11 (KLK11) is a member of tissue kallikrein family which are extracellular serine proteases consisting of 15 members. Two isoforms of KLK11 are differentially expressed. Isoform 1 is predominantly expressed in brain and isoform 2 is preferentially expressed in prostate. Isoform 1 consists of a signal peptide,a short pro peptide and the mature chain.Isoform 2 contains an extra 32 amino acid N terminal to full-length isoform 1.KLK11 is a novel marker for ovarian and prostate cancer carcinomas. KLK11 can be activated by thermolysin and is active against a thioester substrate.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus |
| Post transnational modification: | About 40% of KLK11 is inactivated by internal cleavage after Arg-188. This proteolytic inactivation may be effected by plasminogen. |
| Tissue Specificity: | Expressed in brain, skin and prostate. Isoform 1 is expressed preferentially in brain. Isoform 2 is expressed in prostate. Present in seminal plasma at concentrations ranging from 2 to 37 microg/mL (at protein level). |
| BioGrid: | 116202. 28 interactions. |
|
There are currently no product reviews
|





















.png)












