Recombinant Human Leukocyte Ig-Like Receptor A3/LILRA3/ILT6/CD85e (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEVDHHHHHH |
Source: Human Cells.
MW :46.6kD.
Recombinant Human LILRA3 is produced by our Mammalian expression system and the target gene encoding Thr19-Glu439 is expressed with a 6His tag at the C-terminus. Leukocyte immunoglobulin-like receptor subfamily A member 3 is also known as CD85 antigen-like family member E, Immunoglobulin-like transcript 6, ILT-6, Leukocyte immunoglobulin-like receptor 4, LIR-4 and Monocyte inhibitory receptor HM43/HM31. In humans, it is encoded by the LILRA3 gene. It acts as soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2.It is detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung.
MW :46.6kD.
Recombinant Human LILRA3 is produced by our Mammalian expression system and the target gene encoding Thr19-Glu439 is expressed with a 6His tag at the C-terminus. Leukocyte immunoglobulin-like receptor subfamily A member 3 is also known as CD85 antigen-like family member E, Immunoglobulin-like transcript 6, ILT-6, Leukocyte immunoglobulin-like receptor 4, LIR-4 and Monocyte inhibitory receptor HM43/HM31. In humans, it is encoded by the LILRA3 gene. It acts as soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2.It is detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-glycosylation is required for ligand binding. |
| Tissue Specificity: | Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung. |
| BioGrid: | 116216. 7 interactions. |
|
There are currently no product reviews
|










.png)











