Recombinant Human LILRB5/CD85c/LIR-8 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHHHHHH |
Source: Human Cells.
MW :47.8kD.
Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 is produced by our Mammalian expression system and the target gene encoding Gly24-His456 is expressed with a 6His tag at the C-terminus. Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 (LILRB5/CD85c/LIR-8) belongs to a family of transmembrane glycoproteins that negatively regulate immune cell activation. Mature human LIR-8 consists of a 435 amino acid (aa) extracellular domain with four Iglike domains, a 21 aa transmembrane segment, and a 111 aa cytoplasmic domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIM). Alternative splicing of human LIR-8 generates an isoform that lacks the second Ig-like domain. LIR-8 is expressed on NK cells and in the tryptic granules of mast cells. Following cell activation and degranulation, it is present on the mast cell surface. Activated mast cells may also release soluble forms of LIR-8.
MW :47.8kD.
Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 is produced by our Mammalian expression system and the target gene encoding Gly24-His456 is expressed with a 6His tag at the C-terminus. Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 (LILRB5/CD85c/LIR-8) belongs to a family of transmembrane glycoproteins that negatively regulate immune cell activation. Mature human LIR-8 consists of a 435 amino acid (aa) extracellular domain with four Iglike domains, a 21 aa transmembrane segment, and a 111 aa cytoplasmic domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIM). Alternative splicing of human LIR-8 generates an isoform that lacks the second Ig-like domain. LIR-8 is expressed on NK cells and in the tryptic granules of mast cells. Following cell activation and degranulation, it is present on the mast cell surface. Activated mast cells may also release soluble forms of LIR-8.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Detected in a natural killer (NK) cells. |
| BioGrid: | 116186. 1 interactions. |
|
There are currently no product reviews
|














.png)








