Recombinant Human Tachykinin-3/TAC3 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE |
Source: E. coli.
MW :13.9kD.
Recombinant Human Tachykinin-3 is produced by our E.coli expression system and the target gene encoding Gln17-Glu121 is expressed with a 6His tag at the N-terminus. Tachykinin 3 (TAC3) is a secreted protein that belongs to the Tachykinin family. Tachykinins are active peptides that excite neurons and evoke behavioral responses; they are potent vasodilators and secretagogues, and contract many smooth muscles in pregnancy. TAC3 is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. It is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. TAC3 acts as the ligand for the neurokinin-3 receptor, mutations in this gene are associated with normosmic hypogonadotropic hypogonadism.
MW :13.9kD.
Recombinant Human Tachykinin-3 is produced by our E.coli expression system and the target gene encoding Gln17-Glu121 is expressed with a 6His tag at the N-terminus. Tachykinin 3 (TAC3) is a secreted protein that belongs to the Tachykinin family. Tachykinins are active peptides that excite neurons and evoke behavioral responses; they are potent vasodilators and secretagogues, and contract many smooth muscles in pregnancy. TAC3 is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. It is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. TAC3 acts as the ligand for the neurokinin-3 receptor, mutations in this gene are associated with normosmic hypogonadotropic hypogonadism.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 112729. 10 interactions. |
|
There are currently no product reviews
|

















.png)











