Recombinant Human Ly6/PLAUR Domain-Containing Protein 3/LYPD3/C4.4A (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH |
MW :27.89kD.
Recombinant Human LYPD3 is produced by our Mammalian expression system and the target gene encoding Leu31-His286 is expressed with a 6His tag at the C-terminus. Ly6/PLAUR domain containing3 (LYPD-3) is a GPI-linked protein. The structure of LYPD-3 is similar to the urokinasetype plasminogen activator receptor (uPAR). LYPD-3 is a 6 -100 kDa molecule with variable cell type-specific N-O-linked glycosylation, mature human LYPD-3 contains two uPAR/Ly6 domains and a Ser/Thr/Pro-rich (STP) region includes a protease sensitive site . The interaction of LYPD-3 with Laminin 1 and 5 on neighboring cells promotes the adhesion, spreading, and migration of tumor cells. LYPD-3 additionally interacts with Galectin-3 and the anterior gradient proteins AG-2 and AG-3. LYPD-3 overexpression in non-small cell lung cancer is predictive of increased mortality.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane |
Post transnational modification: | N-glycosylated and O-glycosylated. |
Tissue Specificity: | Expressed in placenta, skin and urothelium. Found in suprabasal keratinocytes of chronic wounds. Weak expression is found in esophagus and peripheral blood mononuclear cells. Found in the majority of primary and metastatic transitional cell carcinomas (TCCs) and as well in breast cancer tissues, but not in adjacent normal tissues. High expression is found in the tumor component of some noninvasive superficial lesions and in invasive and metastatic urothelial cancers. |
BioGrid: | 117985. 117 interactions. |
There are currently no product reviews
|