Recombinant Human Cytoplasmic Dynein Light Chain 1/DYNLL1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Source: E.coli.
MW :12.5kD.
Recombinant Human DYNLL1 is produced by our E.coli expression system and the target gene encoding Met1-Gly89 is expressed with a 6His tag at the N-terminus. Human Dynein Cytoplasmic Light Chain 1 (DYNLL1) has been identified as a protein that interacts with NOS1, leading to NOS1 inhibition. NOS1 dimer is destabilized after binding DYNLL1 a conformation necessary activity, and it regulate numerous biologic processes throughits effects on nitric oxide synthase activity. DYNLL1 is widely expressed, with higher expression in testis and moderate expression in brain.
MW :12.5kD.
Recombinant Human DYNLL1 is produced by our E.coli expression system and the target gene encoding Met1-Gly89 is expressed with a 6His tag at the N-terminus. Human Dynein Cytoplasmic Light Chain 1 (DYNLL1) has been identified as a protein that interacts with NOS1, leading to NOS1 inhibition. NOS1 dimer is destabilized after binding DYNLL1 a conformation necessary activity, and it regulate numerous biologic processes throughits effects on nitric oxide synthase activity. DYNLL1 is widely expressed, with higher expression in testis and moderate expression in brain.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Mitochondrion |
| Post transnational modification: | Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to PubMed:15193260, it is phosphorylated at Ser-88 by PAK1, however, according to PubMed:18650427, the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro. |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 114206. 229 interactions. |
|
There are currently no product reviews
|
















.png)










