Recombinant Human MOB-Like Protein Phocein/MOB4/MOBKL3 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA |
Source: E.coli.
MW :28.2kD.
Recombinant Human MOB-Like Protein Phocein is produced by our E.coli expression system and the target gene encoding Met1-Ala225 is expressed with a 6His tag at the N-terminus. MOB-Like Protein Phocein is a member of the MOB1/Phocein Family. MOB-Like Protein Phocein is associated with membranes and the Golgi stacks. It is present in the cytosol, where it behaves as a protein complex. It has been shown that MOB-Like Protein Phocein interacts with DNM1, EPS15 and Nucleoside Diphosphate Kinase. MOB-Like Protein Phocein is the major partner of Striatin Family members and may play a important role in membrane trafficking, specifically in membrane budding reactions.
MW :28.2kD.
Recombinant Human MOB-Like Protein Phocein is produced by our E.coli expression system and the target gene encoding Met1-Ala225 is expressed with a 6His tag at the N-terminus. MOB-Like Protein Phocein is a member of the MOB1/Phocein Family. MOB-Like Protein Phocein is associated with membranes and the Golgi stacks. It is present in the cytosol, where it behaves as a protein complex. It has been shown that MOB-Like Protein Phocein interacts with DNM1, EPS15 and Nucleoside Diphosphate Kinase. MOB-Like Protein Phocein is the major partner of Striatin Family members and may play a important role in membrane trafficking, specifically in membrane budding reactions.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Membrane, Golgi apparatus |
| Post transnational modification: | Phosphorylated on serine residues. |
| BioGrid: | 117369. 90 interactions. |
|
There are currently no product reviews
|
















.png)







