Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKALLEHHHHHH |
Source: E.coli.
MW :33.37kD.
Recombinant Human Mortality Factor 4-Like Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a 6His tag at the C-terminus. Mortality Factor 4-Like Protein 2 (MORF4L2) is a member of the mortality factor (MORF) family. MORF4L2 localizes in the nucleus, possessing a protein kinase C phosphorylation site and a tyrosine phosphorylation site. MORF4L2 interacts with the Rb tumor suppressor and it has histone deacetylase activity which can either repress or promote the activity of the B-Myb promoter depending on the tissue. In addition, MORF4L2 is involved in cell growth, regulation, and senescence.
MW :33.37kD.
Recombinant Human Mortality Factor 4-Like Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a 6His tag at the C-terminus. Mortality Factor 4-Like Protein 2 (MORF4L2) is a member of the mortality factor (MORF) family. MORF4L2 localizes in the nucleus, possessing a protein kinase C phosphorylation site and a tyrosine phosphorylation site. MORF4L2 interacts with the Rb tumor suppressor and it has histone deacetylase activity which can either repress or promote the activity of the B-Myb promoter depending on the tissue. In addition, MORF4L2 is involved in cell growth, regulation, and senescence.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 115001. 101 interactions. |
|
There are currently no product reviews
|
















.png)











