Recombinant Human Neuritin/NRN1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG |
Source: E. coli.
MW :12.1kD.
Recombinant Human Neuritin is produced by our E.coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus. Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.
MW :12.1kD.
Recombinant Human Neuritin is produced by our E.coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus. Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Cell junction |
| BioGrid: | 119450. 28 interactions. |
|
There are currently no product reviews
|












.png)







