Recombinant Human NPDC1/CAB1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH |
Source: Human Cells.
MW :16.5kD.
Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus. Neural proliferation differentiation and control protein 1(NPDC1) is a protein that in humans is encoded by the NPDC1 gene. It is a single-pass membrane protein and belongs to the NPDC1/cab-1 family. The protein strongly expressed in adult brain and especially in hippocampus, frontal lobe and temporal lobe. The protein suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation and it might be involved in transcriptional regulation.
MW :16.5kD.
Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus. Neural proliferation differentiation and control protein 1(NPDC1) is a protein that in humans is encoded by the NPDC1 gene. It is a single-pass membrane protein and belongs to the NPDC1/cab-1 family. The protein strongly expressed in adult brain and especially in hippocampus, frontal lobe and temporal lobe. The protein suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation and it might be involved in transcriptional regulation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Strongly expressed in adult brain; especially in hippocampus, frontal lobe and temporal lobe. |
| BioGrid: | 121167. 29 interactions. |
|
There are currently no product reviews
|













.png)











