Recombinant Human Nuclear Transcription Factor Y Subunit a/NFYA (N-GST)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Source: E.coli.
MW :60.58kD.
Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed with a GST tag at the N-terminus. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
MW :60.58kD.
Recombinant Human Nuclear TF Y subunit alpha is produced by our E.coli expression system and the target gene encoding Met1-Ser318 is expressed with a GST tag at the N-terminus. Nuclear Transcription Factor Y Subunit a (NFYA) is a member of the NFYA/HAP2 subunit family. NFYA founctions as a heterotrimeric transcription factor , which is composed of three components, NF-YA, NF-YB and NF-YC, binds to CCAAT motifs in the promoter regions in a variety of genes. NFYA forms a highly conserved transcription factor which stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 110866. 56 interactions. |
|
There are currently no product reviews
|













.png)











