Recombinant Human Heat Shock Factor Protein 2/HSF2 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS |
Source: E.coli.
MW :15.9kD.
Recombinant Human Heat Shock Factor Protein-2 is produced by our E.coli expression system and the target gene encoding Ser411-Ser536 is expressed with a 6His tag at the N-terminus. Heat Shock Factor Protein 2 (HSF2) belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked. HSF2 is widely expressed in many cells and tissues. HSF2 is located on Cytoplasmic during normal growth. But when it is activited, HSF2 moves to the nucleus.
MW :15.9kD.
Recombinant Human Heat Shock Factor Protein-2 is produced by our E.coli expression system and the target gene encoding Ser411-Ser536 is expressed with a 6His tag at the N-terminus. Heat Shock Factor Protein 2 (HSF2) belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked. HSF2 is widely expressed in many cells and tissues. HSF2 is located on Cytoplasmic during normal growth. But when it is activited, HSF2 moves to the nucleus.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| BioGrid: | 109531. 41 interactions. |
|
There are currently no product reviews
|
















.png)











