Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human Papillomavirus 11

    Recombinant Human Papillomavirus 11

    Share:

    Recombinant Human Papillomavirus 11

    Roll over image to zoom in

       

    Product code: 32-5614

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    0.5 mg
    $737.50  $590.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Review   (0)
    Amount : 0.5 mg
    Purification : Protein is >95% pure as determined by 12% PAGE (coomassie staining).
    Content : Recombinant HPV11 solution in PBS and 3M Urea, 100mM arginine
    Storage condition : Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
    AA sequence : VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
    Alternative Name : Papillomavirus, HPV, Papilloma Virus.

    Source: E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus-induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candidate for vaccine development.

    Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
     
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-Human TCR Cbeta1 APC (Clone : JOVI.1)

    Anti-Human TCR Cbeta1 APC (Clo...

    details-Anti-Human TCR Cbeta1 APC (Clone : JOVI.1)
    Anti-Mouse CD16/CD32 Antibody (Clone : 93)

    Anti-Mouse CD16/CD32 Antibody ...

    details-Anti-Mouse CD16/CD32 Antibody (Clone : 93)
    SIGLEC9 Stable Cell Line

    SIGLEC9 Stable Cell Line

    details-SIGLEC9 Stable Cell Line
    Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)

    Recombinant Human Xaa-Pro Amin...

    details-Recombinant Human Xaa-Pro Aminopeptidase P3/XPNPEP3 (N, C-6His)
    Recombinant Protein L Cys His Tag

    Recombinant Protein L Cys His ...

    details-Recombinant Protein L Cys His Tag
    Anti-CD49c / Integrin alpha 3 Monoclonal Antibody (Clone:ASC-1)-PE Conjugated

    Anti-CD49c / Integrin alpha 3 ...

    details-Anti-CD49c / Integrin alpha 3 Monoclonal Antibody (Clone:ASC-1)-PE Conjugated
    ANGPTL3 HEK Recombinant Protein

    ANGPTL3 HEK Recombinant Protei...

    details-ANGPTL3 HEK Recombinant Protein
    Anti-Human CD264 APC (Clone : TRAIL-R4-01)

    Anti-Human CD264 APC (Clone : ...

    details-Anti-Human CD264 APC (Clone : TRAIL-R4-01)
    Monoclonal Antibody to Human/Mouse TLR2 (Clone : TL2.3)

    Monoclonal Antibody to Human/M...

    details-Monoclonal Antibody to Human/Mouse TLR2 (Clone : TL2.3)
    Human Lactoferrin (Breast Milk)

    Human Lactoferrin (Breast Milk...

    details-Human Lactoferrin (Breast Milk)
    Anti-p53 Monoclonal Antibody (Clone:IHC053)

    Anti-p53 Monoclonal Antibody (...

    details-Anti-p53 Monoclonal Antibody (Clone:IHC053)
    Recombinant Human Prosaposin

    Recombinant Human Prosaposin

    details-Recombinant Human Prosaposin
    Anti-Human HER-2 (Trastuzumab) – Fc Muted™

    Anti-Human HER-2 (Trastuzumab)...

    details-Anti-Human HER-2 (Trastuzumab) – Fc Muted™
    Anti-SARS-CoV-2 RBD antibody(DM54), Rabbit mAb

    Anti-SARS-CoV-2 RBD antibody(D...

    details-Anti-SARS-CoV-2 RBD antibody(DM54), Rabbit mAb

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    APOH Native Protein

    APOH Native Protein

    Recombinant Human VCAM-1(Discontinued)

    Recombinant Human VCAM-1(Discontinued)

    rmEotaxin Recombinant Protein

    rmEotaxin Recombinant Protein

    close

    Please Login to write a Review !!


    close

    Recombinant Human Papillomavirus 11

    Product code: 32-5614
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart