Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Papillomavirus 11

Recombinant Human Papillomavirus 11

Share:

Recombinant Human Papillomavirus 11

Roll over image to zoom in

   

Product code: 32-5614

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
0.5 mg
$819.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 0.5 mg
Purification : Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Content : Recombinant HPV11 solution in PBS and 3M Urea, 100mM arginine
Storage condition : Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
AA sequence : VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
Alternative Name : Papillomavirus, HPV, Papilloma Virus.

Source: E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus-induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candidate for vaccine development.

Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
 
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Human TCR Cbeta1 APC (Clone : JOVI.1)

Anti-Human TCR Cbeta1 APC (Clo...

details-Anti-Human TCR Cbeta1 APC (Clone : JOVI.1)
Anti-Mouse CD16/CD32 Antibody (Clone : 93)

Anti-Mouse CD16/CD32 Antibody ...

details-Anti-Mouse CD16/CD32 Antibody (Clone : 93)
Recombinant Protein L Cys His Tag

Recombinant Protein L Cys His ...

details-Recombinant Protein L Cys His Tag
Anti-gamma-Tubulin Monoclonal Antibody (Clone: GTU-88)

Anti-gamma-Tubulin Monoclonal ...

details-Anti-gamma-Tubulin Monoclonal Antibody (Clone: GTU-88)
HP-NAP Recombinant Protein

HP-NAP Recombinant Protein

details-HP-NAP Recombinant Protein
ANGPTL3 HEK Recombinant Protein

ANGPTL3 HEK Recombinant Protei...

details-ANGPTL3 HEK Recombinant Protein
Anti-Arginase-1 Monoclonal Antibody (Clone:IHC400)

Anti-Arginase-1 Monoclonal Ant...

details-Anti-Arginase-1 Monoclonal Antibody (Clone:IHC400)
Anti-p53 Monoclonal Antibody (Clone:IHC053)

Anti-p53 Monoclonal Antibody (...

details-Anti-p53 Monoclonal Antibody (Clone:IHC053)
Recombinant Human Prosaposin

Recombinant Human Prosaposin

details-Recombinant Human Prosaposin
Human ACE2 Protein His Tag (1-740 aa)

Human ACE2 Protein His Tag (1-...

details-Human ACE2 Protein His Tag (1-740 aa)
Anti-Nanog Monoclonal Antibody (Clone:IHC634)-Ready to Use

Anti-Nanog Monoclonal Antibody...

details-Anti-Nanog Monoclonal Antibody (Clone:IHC634)-Ready to Use
Monoclonal Antibody to Human CD48 NALE™ Purified (Clone: 156-4H9)

Monoclonal Antibody to Human C...

details-Monoclonal Antibody to Human CD48 NALE™ Purified (Clone: 156-4H9)
Rat NKG2A/C/E Monoclonal Antibody (Clone: WEN28)

Rat NKG2A/C/E Monoclonal Antib...

details-Rat NKG2A/C/E Monoclonal Antibody (Clone: WEN28)
Anti-Human TNF alpha (Adalimumab) – Biotin

Anti-Human TNF alpha (Adalimum...

details-Anti-Human TNF alpha (Adalimumab) – Biotin

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Recombinant Chlamydia Pneumonia

Recombinant Chlamydia Pneumonia

Mouse Interleukin-4

Mouse Interleukin-4

IL 18 Recombinant Protein

IL 18 Recombinant Protein

New Products

Recombinant Human IL-5 (C-mFc)

Recombinant Human IL-5 (C-mFc)

Recombinant Human Glyoxalase domain-containing protein 4/GLOD4(C-His)

Recombinant Human Glyoxalase domain-containing protein 4/GLOD4(C-His)

Recombinant Human Inner centromere protein

Recombinant Human Inner centromere protein

close

Please Login to write a Review !!


close

Recombinant Human Papillomavirus 11

Product code: 32-5614
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart