Recombinant Human Papillomavirus 6
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 0.5 mg |
| Purification : | Protein is >95% pure as determined by 12% PAGE (coomassie staining). |
| Content : | PBS, 20mM Arginine, 0.6M Urea and 0.02% Sodium Azide. |
| Storage condition : | Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| AA sequence : | VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK. |
| Alternative Name : | Papillomavirus, HPV, Papilloma Virus. |
Source : E.Coli.
Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|


















.png)








