Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human PD-L1 Fc Fusion Protein (Active)

Recombinant Human PD-L1 Fc Fusion Protein (Active)

Share:

Figure-1: Recombinant Human PD-L1 Fc Fusion Protein. 0.5 ug protein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.

Recombinant Human PD-L1 Fc Fusion Protein  (Active)
Recombinant Human PD-L1 Fc Fusion Protein  (Active)
Recombinant Human PD-L1 Fc Fusion Protein  (Active)
Recombinant Human PD-L1 Fc Fusion Protein  (Active)
Recombinant Human PD-L1 Fc Fusion Protein  (Active)

Roll over image to zoom in

   
Figure-1: Recombinant Human PD-L1 Fc Fusion Protein. 0.5 ug protein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.
Figure-2: Western blot analysis of Recombinant Human PDL-1 Fc Fusion Protein (0.5ug) using anti-human PD-L1 antibody (Cat. No. 10-7599).
Figure-3: Binding activity of Recombinant Human PD-L1 Fc Fusion Protein to PD-1 was analyzed by flow cytometry. 0.1 ug of Recombinant Human PD-L1 Fc Fusion Protein was incubated with PD-1/CHO-K1 stable cells (Cat. No. 14-500ACL) or with parental CHO-K1 cells at 1 x 10^6 cells/reaction on ice for 1 h. Cells were washed once and then further incubated with FITC-conjugated goat anti-hFc antibody on ice for 30 min. Cells were washed and then analyzed by flow cytometry. PD-1/CHO-K1 stable cells (Red); Parental CHO-K1 cells (Green).
Figure-4: HPLC analysis of Recombinant Human PD-L1 Fc Fusion Protein
Figure 5:  Binding activity of Recombinant Human PD-L1 Fc Fusion Protein to PD-1/ CHO stable cell line (14-500ACL) was analyzed by cell based ELISA. PD-1/CHO cells were plated into 96 well ELISA plate over night. Next day, plate was washed in PBS and fixed in fixation buffer (Abeomics) for 15 min. Cells were blocked in blocking reagent (Abeomics) for 30 min. Then, Recombinant Human PD-L1 Fc Fusion Protein was added in different dilution to cells and incubated in room temp. for 1 hr. Plate was wash 3 times in TBST wash buffer. Goat anti-human HRP was added and incubated at room temp. for 30 min. Then plate was washed 4 times in TBST and analyzed in ELISA reader in 450 nm.

Product code: 21-1001

Application : Functional Assay, ELISA, FACS, WB

Shipping Info:

Order now and get it on Tuesday January 31, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   25 µg

  •  100 µg

  • $105.00 

  • $360.00 

Add to Wish List

Bulk Order

Shipping Info:

Order now and get it on Tuesday January 31, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 100 µg
Purification : 99% Purity SDS -PAGE and HPLC.
Content : Lyophilized sterile PBS, 5% trehalose and 0.01% tween 80 are added as protectant before lyophilization.
Storage condition : Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
AA sequence : Human PD-L1 (ECD): MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPV EKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLL KDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA PYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLS GKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENH TAELVIPELPLAHPPNER
Alternative Name : B7 homolog 1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1

Host: CHO-K1 celline. PD-L1 (CD274/B7-H1) is a critical membrane-bound costimulatory molecule belongs to the B7 superfamily that inhibits immune responses through its receptor, PD-1 and PD-L1 play a key role in the pathogenesis of inflammatory diseases (programmed death 1). It is widely expressed in the mononuclear phagocyte system (MPS), may co-stimulate T cells and regulates inflammatory responses. PD-L1 exerts inflammation regulatory functions via a negative co-stimulatory effect on T cell functions to inhibit cytokine secretion, facilitate apoptosis of activated T cells and induce T cell anergy. Aberrant expression and dysregulation of CD274 have been reported during bacterial infection, inflammation and in numerous autoimmune diseases. 

Functional assay: Measured by its binding ability in a functional FLOW . Binding assay was tested using CHO-K1/PD-1  (cat no. 14-500ACL). 

Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Mouse Anti-Human Tollip

Mouse Anti-Human Tollip

details-Mouse Anti-Human Tollip
Anti-Collagen Type IV Monoclonal Antibody (Clone:IHC549)

Anti-Collagen Type IV Monoclon...

details-Anti-Collagen Type IV Monoclonal Antibody (Clone:IHC549)
Mouse IgG1 Isotype Control DyLight<sup>®</sup> 488 (Clone : MOPC-21)

Mouse IgG1 Isotype Control DyL...

details-Mouse IgG1 Isotype Control DyLight<sup>®</sup> 488 (Clone : MOPC-21)
Anti-p27 Monoclonal Antibody (Clone:IHC027)

Anti-p27 Monoclonal Antibody (...

details-Anti-p27 Monoclonal Antibody (Clone:IHC027)
Anti-Cytokeratin 18 Monoclonal Antibody (Clone:C-04)

Anti-Cytokeratin 18 Monoclonal...

details-Anti-Cytokeratin 18 Monoclonal Antibody (Clone:C-04)
Anti-Caspase-3 Polyclonal Antibody

Anti-Caspase-3 Polyclonal Anti...

details-Anti-Caspase-3 Polyclonal Antibody
Human aFGF / FGF1 Recombinant Protein(Discontinued)

Human aFGF / FGF1 Recombinant ...

details-Human aFGF / FGF1 Recombinant Protein(Discontinued)
Anti-MEK1/2 Antibody

Anti-MEK1/2 Antibody

details-Anti-MEK1/2 Antibody
Monoclonal Antibody to Human TLR6 (Clone :  TLR6.127)

Monoclonal Antibody to Human T...

details-Monoclonal Antibody to Human TLR6 (Clone :  TLR6.127)
Anti-BCMA Antibody (belantamab biosimilar) (J6M0)

Anti-BCMA Antibody (belantamab...

details-Anti-BCMA Antibody (belantamab biosimilar) (J6M0)
Anti-Human VEGF (Bevacizumab) – Fc Muted™ Biotin

Anti-Human VEGF (Bevacizumab) ...

details-Anti-Human VEGF (Bevacizumab) – Fc Muted™ Biotin
Anti-Human CD167a PE (Clone : 51D6)

Anti-Human CD167a PE (Clone : ...

details-Anti-Human CD167a PE (Clone : 51D6)
Monoclonal antibody to MHC classII (Clone: ABM56C9)

Monoclonal antibody to MHC cla...

details-Monoclonal antibody to MHC classII (Clone: ABM56C9)
TSLP, His Recombinant Protein

TSLP, His Recombinant Protein

details-TSLP, His Recombinant Protein

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

CENPB Recombinant Protein

CENPB Recombinant Protein

GMF b Recombinant Protein

GMF b Recombinant Protein

Recombinant Human DKK-3(Discontinued)

Recombinant Human DKK-3(Discontinued)

New Products

Biotinylated Human HLA-A*0201 GP100 complex Protein (C-Avi-10His)

Biotinylated Human HLA-A*0201 GP100 complex Protein (C-Avi-10His)

Recombinant Human TAF1L Protein(C-His)

Recombinant Human TAF1L Protein(C-His)

Recombinant Human C/EBP gamma(C-His)

Recombinant Human C/EBP gamma(C-His)

close

Please Login to write a Review !!


close

Recombinant Human PD-L1 Fc Fusion Protein (Active)

Product code: 21-1001
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart