Recombinant Human Proenkephalin-A (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFVDHHHHHH |
Source: Human Cells.
MW :29.2kD.
Recombinant Human Proenkephalin-A is produced by our Mammalian expression system and the target gene encoding Glu25-Phe267 is expressed with a 6His tag at the C-terminus. Proenkephalin-A is a secreted protein that belongs to the opioid neuropeptide precursor family. Proenkephalin-A is an endogenous opioid polypeptide hormone which, via proteolyic cleavage, produces the enkephalin peptides [Met]enkephalin, and to a lesser extent, [Leu]enkephalin. Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. Proenkephalin-A (114-133) and Proenkephalin-A (237-258) increase glutamate release in the striatum. Proenkephalin-A (114-133) decreases GABA concentration in the striatum.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. |
| BioGrid: | 111205. 8 interactions. |
|
There are currently no product reviews
|













.png)







