Recombinant Human Regenerating Islet-Derived Protein 4/RELP (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPVDHHHHHH |
Source: Human Cells.
MW :19.2kD.
Recombinant Human Regenerating islet-derived protein 4 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro158 is expressed with a 6His tag at the C-terminus. REG4 is a secreted contains one C-type lectin domain, high expressed in the gastrointestinal tract, including jejunum, ileum, appendix, pancreas and small intestine. REG4 can be up-regulated by mucosal injury from active CrohnÂ’s disease or ulcerative colitis. In the acid environment, REG4 can maintain carbohydrate recognition activity. REG4 may be involved in inflammatory and metaplastic response of the gastrointestinal epithelium.
MW :19.2kD.
Recombinant Human Regenerating islet-derived protein 4 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro158 is expressed with a 6His tag at the C-terminus. REG4 is a secreted contains one C-type lectin domain, high expressed in the gastrointestinal tract, including jejunum, ileum, appendix, pancreas and small intestine. REG4 can be up-regulated by mucosal injury from active CrohnÂ’s disease or ulcerative colitis. In the acid environment, REG4 can maintain carbohydrate recognition activity. REG4 may be involved in inflammatory and metaplastic response of the gastrointestinal epithelium.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells. |
| BioGrid: | 123843. 7 interactions. |
|
There are currently no product reviews
|




















.png)









