Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH |
MW :11.7kD.
Recombinant Human S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu93 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. It can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted, Cytoplasm, Cytoplasm, Cell membrane |
BioGrid: | 112187. 56 interactions. |
There are currently no product reviews
|