Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
Source: E. coli.
MW :16.3kD.
Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus. SH2 Domain-Containing Protein 1A,(SH2D1A) contains one SH2 domain and a short tail and is localized in the cytoplasm. SH2D1A is expressed at a high level in the thymus and the lung, with lower expression levels in the spleen and the liver. SH2D1A acts as an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. In addition, SH2D1A mediates interaction between FYN and SLAMF1. It is also thought to regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
MW :16.3kD.
Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus. SH2 Domain-Containing Protein 1A,(SH2D1A) contains one SH2 domain and a short tail and is localized in the cytoplasm. SH2D1A is expressed at a high level in the thymus and the lung, with lower expression levels in the spleen and the liver. SH2D1A acts as an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. In addition, SH2D1A mediates interaction between FYN and SLAMF1. It is also thought to regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm |
Tissue Specificity: | Expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T-lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis. |
BioGrid: | 110246. 23 interactions. |
There are currently no product reviews
|