Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human Small Ubiquitin-Related Modifier 2

Recombinant Human Small Ubiquitin-Related Modifier 2

Share:

Recombinant Human Small Ubiquitin-Related Modifier 2

Roll over image to zoom in

   

Product code: 32-5008

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 µg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Review   (0)
Amount : 50 µg
Purification : Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Content : The SUMO2 containing 20 mM Tris-HCl buffer (pH 8.0)
Storage condition : Can be stored at +4C for 1 week. For long term storage , below -20C. Please prevent freeze-thaw cycles.
AA sequence : MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.
Alternative Name : Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Source : Escherichia Coli. SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa.The SUMO-2 is purified by proprietary chromatographic techniques. Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. Unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. All SUMO proteins share the conserved ubiquitin domain and the C-terminal diglycine cleavage/attachment site. Human SUMO2, also known as Sentrin2 and SMT3B is synthesized as a 95 amino acid (aa), 11 kDa propeptide that contains a two aa C-terminal prosegment, and an 18 aa N-terminal protein interacting region (aa 33 -50). Following prosegment cleavage, the C-terminal glycine is enzymatically attached to a lysine on a target protein. Human SUMO2 shares 100% sequence identity to SUMO-2 from mouse. SUMO2 also has very high sequence homology to SUMO3 and SUMO4, 86 % and 85%, respectively. SUMO2 shares only 44% sequence identity to SUMO1.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Recombinant Human Fibrillin-1/Asprosin (N-8His)

Recombinant Human Fibrillin-1/...

details-Recombinant Human Fibrillin-1/Asprosin (N-8His)
Anti-TIM3 Monoclonal Antibody (Clone:IHC003)

Anti-TIM3 Monoclonal Antibody ...

details-Anti-TIM3 Monoclonal Antibody (Clone:IHC003)
Anti-Human CD49D (Integrin alpha 4) (Natalizumab) – PE

Anti-Human CD49D (Integrin alp...

details-Anti-Human CD49D (Integrin alpha 4) (Natalizumab) – PE
Anti-CD38 antibody(DM28), Rabbit mAb

Anti-CD38 antibody(DM28), Rabb...

details-Anti-CD38 antibody(DM28), Rabbit mAb
Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) PerCP(Discontinued)

Anti-HSP90 beta Monoclonal Ant...

details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) PerCP(Discontinued)
Recombinant 2019-nCoV Spike RBD Protein His tag

Recombinant 2019-nCoV Spike RB...

details-Recombinant 2019-nCoV Spike RBD Protein His tag
Recombinant human IFNAR2 protein with C-terminal human Fc tag

Recombinant human IFNAR2 prote...

details-Recombinant human IFNAR2 protein with C-terminal human Fc tag
Anti-Human CD56 PE-DyLight® 594 (Clone : LT56)

Anti-Human CD56 PE-DyLight® 5...

details-Anti-Human CD56 PE-DyLight® 594 (Clone : LT56)
Peroxidase conjugated Donkey anti Goat IgG (H+L)

Peroxidase conjugated Donkey a...

details-Peroxidase conjugated Donkey anti Goat IgG (H+L)
AHSP Recombinant Protein

AHSP Recombinant Protein

details-AHSP Recombinant Protein
Anti-CD370 Antibody (Clone : 8F9)

Anti-CD370 Antibody (Clone : 8...

details-Anti-CD370 Antibody (Clone : 8F9)
Recombinant Human ACE2 His and FLAG Tag

Recombinant Human ACE2 His and...

details-Recombinant Human ACE2 His and FLAG Tag
CTDSPL Recombinant Protein

CTDSPL Recombinant Protein

details-CTDSPL Recombinant Protein
Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use

Anti-Tau Monoclonal Antibody (...

details-Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

HHEX Recombinant Protein

HHEX Recombinant Protein

PTPN1 Recombinant Protein

PTPN1 Recombinant Protein

Recombinant Human Olfactomedin 1

Recombinant Human Olfactomedin 1

New Products

IL19 Human, HEK

IL19 Human, HEK

Anti-Ms CD3 FITC

Anti-Ms CD3 FITC

Recombinant Rat PD-1 (C-His)

Recombinant Rat PD-1 (C-His)

close

Please Login to write a Review !!


close

Recombinant Human Small Ubiquitin-Related Modifier 2

Product code: 32-5008
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart