Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human Small Ubiquitin-Related Modifier 2

    Recombinant Human Small Ubiquitin-Related Modifier 2

    Share:

    Recombinant Human Small Ubiquitin-Related Modifier 2

    Roll over image to zoom in

       

    Product code: 32-5008

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    50 µg
    $325.00  $260.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Review   (0)
    Amount : 50 µg
    Purification : Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
    Content : The SUMO2 containing 20 mM Tris-HCl buffer (pH 8.0)
    Storage condition : Can be stored at +4C for 1 week. For long term storage , below -20C. Please prevent freeze-thaw cycles.
    AA sequence : MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.
    Alternative Name : Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

    Source : Escherichia Coli. SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa.The SUMO-2 is purified by proprietary chromatographic techniques. Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. Unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. All SUMO proteins share the conserved ubiquitin domain and the C-terminal diglycine cleavage/attachment site. Human SUMO2, also known as Sentrin2 and SMT3B is synthesized as a 95 amino acid (aa), 11 kDa propeptide that contains a two aa C-terminal prosegment, and an 18 aa N-terminal protein interacting region (aa 33 -50). Following prosegment cleavage, the C-terminal glycine is enzymatically attached to a lysine on a target protein. Human SUMO2 shares 100% sequence identity to SUMO-2 from mouse. SUMO2 also has very high sequence homology to SUMO3 and SUMO4, 86 % and 85%, respectively. SUMO2 shares only 44% sequence identity to SUMO1.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Rabbit IgG Control (Whole Molecule), Purified

    Rabbit IgG Control (Whole Mole...

    details-Rabbit IgG Control (Whole Molecule), Purified
    Monoclonal Antibody to human CD14

    Monoclonal Antibody to human C...

    details-Monoclonal Antibody to human CD14
    MMLV RT Recombinant Protein

    MMLV RT Recombinant Protein

    details-MMLV RT Recombinant Protein
    Polyclonal Antibody to SARS-CoV-2 nucleocapsid Protein Biotin Conjugated

    Polyclonal Antibody to SARS-Co...

    details-Polyclonal Antibody to SARS-CoV-2 nucleocapsid Protein Biotin Conjugated
    Recombinant Human PD-L1 Fc Fusion Protein  (Active)

    Recombinant Human PD-L1 Fc Fus...

    details-Recombinant Human PD-L1 Fc Fusion Protein  (Active)
    Monoclonal Antibody to Mouse TIGIT (Clone: 1G9)

    Monoclonal Antibody to Mouse T...

    details-Monoclonal Antibody to Mouse TIGIT (Clone: 1G9)
    Anti-Human DR5 (Drozitumab) – Fc Muted™ Biotin

    Anti-Human DR5 (Drozitumab) –...

    details-Anti-Human DR5 (Drozitumab) – Fc Muted™ Biotin
    Recombinant Human Pituitary Tumor-Transforming Protein 1

    Recombinant Human Pituitary Tu...

    details-Recombinant Human Pituitary Tumor-Transforming Protein 1
    Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use

    Anti-Tau Monoclonal Antibody (...

    details-Anti-Tau Monoclonal Antibody (Clone:IHC696)-Ready to Use
    Anti-Cytokeratin 19 Monoclonal Antibody (Clone:BA-17)-Biotin Conjugated

    Anti-Cytokeratin 19 Monoclonal...

    details-Anti-Cytokeratin 19 Monoclonal Antibody (Clone:BA-17)-Biotin Conjugated
    Anti-HSP60 Monoclonal Antibody (Clone : LK2) ATTO 488

    Anti-HSP60 Monoclonal Antibody...

    details-Anti-HSP60 Monoclonal Antibody (Clone : LK2) ATTO 488
    CD5L HEK Recombinant Protein

    CD5L HEK Recombinant Protein

    details-CD5L HEK Recombinant Protein
    Anti-GFAP Monoclonal Antibody (Clone:GF-01)

    Anti-GFAP Monoclonal Antibody ...

    details-Anti-GFAP Monoclonal Antibody (Clone:GF-01)
    Mouse Monoclonal Antibody to Human RPL17 (Clone : 15B3F5)(Discontinued)

    Mouse Monoclonal Antibody to H...

    details-Mouse Monoclonal Antibody to Human RPL17 (Clone : 15B3F5)(Discontinued)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Herpes Simplex Virus-2 VP13/14

    Recombinant Herpes Simplex Virus-2 VP13/14

    Recombinant Human Flap Endonuclease 1/FEN-1

    Recombinant Human Flap Endonuclease 1/FEN-1

    AMD1 Recombinant Protein

    AMD1 Recombinant Protein

    close

    Please Login to write a Review !!


    close

    Recombinant Human Small Ubiquitin-Related Modifier 2

    Product code: 32-5008
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart