Recombinant Human SOD2/Mn-SOD (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,100mM NaCl,50% glycerol,pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MHHHHHHDDDDKKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
Source: E.coli.
MW :23.7kD.
Recombinant Human Superoxide Dismutase [Mn] Mitochondrial is produced by our E.coli expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the N-terminus. Superoxide Dismutase (SOD2) is a number of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. The SOD2 protein transforms toxic superoxide and a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. Genetic variation in SOD2 is associated with microvascular complications of diabetes type 6 (MVCD6), idiopathic cardiomyopathy (IDC), sporadic motor neuron disease, and cancer. SOD2 destroys superoxide anion radicals which are usually produced within the cells and which are toxic to biological systems.
MW :23.7kD.
Recombinant Human Superoxide Dismutase [Mn] Mitochondrial is produced by our E.coli expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the N-terminus. Superoxide Dismutase (SOD2) is a number of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. The SOD2 protein transforms toxic superoxide and a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. Genetic variation in SOD2 is associated with microvascular complications of diabetes type 6 (MVCD6), idiopathic cardiomyopathy (IDC), sporadic motor neuron disease, and cancer. SOD2 destroys superoxide anion radicals which are usually produced within the cells and which are toxic to biological systems.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion matrix |
| Post transnational modification: | Acetylation at Lys-122 decreases enzymatic activity. Deacetylated by SIRT3 upon exposure to ionizing radiations or after long fasting (By similarity). |
| BioGrid: | 112531. 38 interactions. |
|
There are currently no product reviews
|

















.png)













