Recombinant Human Stratifin/SFN(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, 1mM EDTA, 1mM DTT, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
Source: E.coli.
MW :27.77kD.
Recombinant Human Stratifin is produced by our E.coli expression system and the target gene encoding Met1-Ser248 is expressed. Stratifin (SFN) belongs to the 14-3-3 family of proteins that act as important regulators of intracelluar signal transduction through their ability to bind specific motifs phosphorylated on serine or threonine. There are at least seven isoforms that have been identified in mammals (beta, gamma, epsilon, sigma, zeta, tau and eta). SFN can detected in many tissues, highly expressed in stratified squamous keratinizing epithelium. SFN is indicated as an epithelial cell marker and serves as a tumor suppressor whose expression can be down regulated by methylation. In addition, SFN plays a key role in maintaining the G2 checkpoint in cells and preventing mitotic death.
MW :27.77kD.
Recombinant Human Stratifin is produced by our E.coli expression system and the target gene encoding Met1-Ser248 is expressed. Stratifin (SFN) belongs to the 14-3-3 family of proteins that act as important regulators of intracelluar signal transduction through their ability to bind specific motifs phosphorylated on serine or threonine. There are at least seven isoforms that have been identified in mammals (beta, gamma, epsilon, sigma, zeta, tau and eta). SFN can detected in many tissues, highly expressed in stratified squamous keratinizing epithelium. SFN is indicated as an epithelial cell marker and serves as a tumor suppressor whose expression can be down regulated by methylation. In addition, SFN plays a key role in maintaining the G2 checkpoint in cells and preventing mitotic death.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Secreted |
| Post transnational modification: | Ubiquitinated. Ubiquitination by RFFL induces proteasomal degradation and indirectly regulates p53/TP53 activation. |
| Tissue Specificity: | Present mainly in tissues enriched in stratified squamous keratinizing epithelium. |
| BioGrid: | 109072. 259 interactions. |
|
There are currently no product reviews
|















.png)







